Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7W8Z7

Protein Details
Accession S7W8Z7    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MKTPRRRLNFRTPTRKKIERPNIKLTNIHydrophilic
NLS Segment(s)
PositionSequence
5-59RRRLNFRTPTRKKIERPNIKLTNIKDKNIESKVNKKETIKKNTKVSGGKSKKNEK
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR031519  DUF5094  
Pfam View protein in Pfam  
PF17015  DUF5094  
Amino Acid Sequences MKTPRRRLNFRTPTRKKIERPNIKLTNIKDKNIESKVNKKETIKKNTKVSGGKSKKNEKVEKIENIKINKDSDMNIHEDDIFSEYKDILYKIKDVQQELIENYIAENNHLRVMKKDVLHYKKFIGWEINDTEDGYQCTYDVEYKGTRKMIKFLLIEEDDAYEYKLIENVNVDLPEYLADDIWFGSQQLCEFFYSVMRAVLTKVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.84
4 0.84
5 0.85
6 0.84
7 0.83
8 0.84
9 0.83
10 0.79
11 0.77
12 0.71
13 0.71
14 0.64
15 0.59
16 0.53
17 0.48
18 0.52
19 0.5
20 0.54
21 0.49
22 0.54
23 0.6
24 0.62
25 0.64
26 0.62
27 0.67
28 0.68
29 0.73
30 0.73
31 0.72
32 0.73
33 0.74
34 0.75
35 0.71
36 0.68
37 0.68
38 0.66
39 0.67
40 0.67
41 0.71
42 0.71
43 0.75
44 0.75
45 0.7
46 0.71
47 0.71
48 0.71
49 0.68
50 0.66
51 0.62
52 0.57
53 0.54
54 0.47
55 0.41
56 0.34
57 0.28
58 0.23
59 0.21
60 0.2
61 0.2
62 0.18
63 0.17
64 0.16
65 0.14
66 0.14
67 0.13
68 0.11
69 0.08
70 0.08
71 0.07
72 0.07
73 0.08
74 0.08
75 0.08
76 0.09
77 0.1
78 0.12
79 0.17
80 0.19
81 0.19
82 0.21
83 0.21
84 0.21
85 0.2
86 0.19
87 0.14
88 0.11
89 0.11
90 0.1
91 0.08
92 0.07
93 0.08
94 0.07
95 0.11
96 0.12
97 0.12
98 0.12
99 0.18
100 0.21
101 0.22
102 0.27
103 0.33
104 0.39
105 0.42
106 0.42
107 0.39
108 0.37
109 0.37
110 0.33
111 0.27
112 0.21
113 0.22
114 0.22
115 0.22
116 0.19
117 0.19
118 0.17
119 0.14
120 0.14
121 0.11
122 0.09
123 0.07
124 0.07
125 0.08
126 0.09
127 0.09
128 0.11
129 0.14
130 0.17
131 0.21
132 0.25
133 0.28
134 0.27
135 0.31
136 0.31
137 0.34
138 0.33
139 0.3
140 0.33
141 0.3
142 0.29
143 0.25
144 0.23
145 0.17
146 0.17
147 0.16
148 0.09
149 0.08
150 0.08
151 0.09
152 0.08
153 0.09
154 0.1
155 0.11
156 0.14
157 0.14
158 0.14
159 0.12
160 0.12
161 0.12
162 0.11
163 0.1
164 0.07
165 0.07
166 0.07
167 0.07
168 0.08
169 0.08
170 0.07
171 0.08
172 0.08
173 0.09
174 0.11
175 0.12
176 0.12
177 0.13
178 0.13
179 0.14
180 0.16
181 0.16
182 0.15
183 0.14
184 0.14