Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7W5H0

Protein Details
Accession S7W5H0    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
74-98RIYDDRKINEKKKRRDSNLRAKTNEBasic
NLS Segment(s)
PositionSequence
84-88KKKRR
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002109  Glutaredoxin  
IPR004480  Monothiol_GRX-rel  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0015036  F:disulfide oxidoreductase activity  
Pfam View protein in Pfam  
PF00462  Glutaredoxin  
PROSITE View protein in PROSITE  
PS51354  GLUTAREDOXIN_2  
Amino Acid Sequences MAEENLNNEFFILSQNNNIIAHDNDESIPQKFFDIIDNDKYILIDLKTSDTLKEAFIKYFGVKKLPVLISYNVRIYDDRKINEKKKRRDSNLRAKTNEIIENTINSSKIVIFIKGTPERPECKFSRALINLFDEMNLVNGRDYNYYNIFLNNHVRSLLKEINSWPTFPQVYIDKVFCGGLDILKQMKDKKVLEKMIFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.19
4 0.19
5 0.2
6 0.19
7 0.17
8 0.19
9 0.17
10 0.17
11 0.15
12 0.19
13 0.2
14 0.19
15 0.19
16 0.15
17 0.15
18 0.14
19 0.15
20 0.16
21 0.19
22 0.21
23 0.25
24 0.26
25 0.26
26 0.25
27 0.25
28 0.2
29 0.18
30 0.14
31 0.11
32 0.1
33 0.12
34 0.15
35 0.15
36 0.15
37 0.14
38 0.15
39 0.15
40 0.19
41 0.18
42 0.16
43 0.16
44 0.17
45 0.17
46 0.22
47 0.22
48 0.2
49 0.19
50 0.19
51 0.25
52 0.24
53 0.24
54 0.23
55 0.24
56 0.25
57 0.26
58 0.27
59 0.21
60 0.21
61 0.2
62 0.19
63 0.24
64 0.25
65 0.25
66 0.31
67 0.39
68 0.46
69 0.55
70 0.63
71 0.65
72 0.71
73 0.79
74 0.8
75 0.83
76 0.85
77 0.87
78 0.87
79 0.84
80 0.75
81 0.67
82 0.61
83 0.52
84 0.45
85 0.35
86 0.26
87 0.19
88 0.18
89 0.18
90 0.16
91 0.14
92 0.1
93 0.1
94 0.07
95 0.1
96 0.1
97 0.09
98 0.09
99 0.1
100 0.16
101 0.19
102 0.2
103 0.22
104 0.25
105 0.28
106 0.3
107 0.35
108 0.3
109 0.31
110 0.34
111 0.31
112 0.37
113 0.36
114 0.35
115 0.32
116 0.32
117 0.29
118 0.25
119 0.24
120 0.15
121 0.12
122 0.12
123 0.09
124 0.07
125 0.06
126 0.07
127 0.09
128 0.1
129 0.11
130 0.13
131 0.15
132 0.17
133 0.17
134 0.18
135 0.18
136 0.19
137 0.26
138 0.23
139 0.22
140 0.21
141 0.21
142 0.21
143 0.27
144 0.29
145 0.22
146 0.24
147 0.25
148 0.34
149 0.35
150 0.35
151 0.29
152 0.29
153 0.28
154 0.26
155 0.28
156 0.21
157 0.25
158 0.27
159 0.27
160 0.22
161 0.23
162 0.22
163 0.18
164 0.18
165 0.14
166 0.12
167 0.13
168 0.15
169 0.16
170 0.2
171 0.24
172 0.26
173 0.31
174 0.37
175 0.4
176 0.47
177 0.54
178 0.6