Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7W4V6

Protein Details
Accession S7W4V6   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
70-91KLCPMCRKPFTIKKKYKCCSVDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, mito_nucl 13.666, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024991  RING-H2_APC11  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0097602  F:cullin family protein binding  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0008270  F:zinc ion binding  
GO:0031145  P:anaphase-promoting complex-dependent catabolic process  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF12861  zf-ANAPC11  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MKRIRIKSIMPTFSWKWSLNQSTNMCCICQQEFEQMCFECNHPTSCVPCIGNCKHIFHFHCISAWMETNKLCPMCRKPFTIKKKYKCCSVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.42
3 0.36
4 0.4
5 0.45
6 0.41
7 0.47
8 0.45
9 0.43
10 0.47
11 0.44
12 0.36
13 0.3
14 0.29
15 0.22
16 0.21
17 0.19
18 0.24
19 0.25
20 0.25
21 0.27
22 0.24
23 0.24
24 0.22
25 0.22
26 0.15
27 0.15
28 0.15
29 0.14
30 0.15
31 0.15
32 0.16
33 0.17
34 0.15
35 0.15
36 0.21
37 0.2
38 0.27
39 0.27
40 0.29
41 0.29
42 0.35
43 0.36
44 0.35
45 0.37
46 0.3
47 0.29
48 0.27
49 0.26
50 0.22
51 0.23
52 0.18
53 0.16
54 0.16
55 0.18
56 0.21
57 0.21
58 0.2
59 0.24
60 0.32
61 0.4
62 0.44
63 0.48
64 0.54
65 0.63
66 0.72
67 0.76
68 0.79
69 0.79
70 0.86
71 0.86