Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7WDK0

Protein Details
Accession S7WDK0   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
162-187GRNNTPKADRFKEKRKHNILHHGGDYBasic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035992  Ricin_B-like_lectins  
IPR000772  Ricin_B_lectin  
CDD cd00161  RICIN  
Amino Acid Sequences MFLYIYLVFSKYLLDGEYDITLSEDNKLKITRNDENIVLQESGSSVLLNNPDSIKFIDDNGDYNIAFADNHYLTVDNNNINITKDQNNKSRFEIKLSPRGYKIMSEDKCLTAKDDSSIVLEKCQDRNKNSLWNIKPKSQPSENIVTFNYKTESLPKHAHLGGRNNTPKADRFKEKRKHNILHHGGDYNLLEIQQSLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.11
4 0.12
5 0.11
6 0.1
7 0.1
8 0.1
9 0.09
10 0.13
11 0.16
12 0.16
13 0.19
14 0.21
15 0.24
16 0.29
17 0.37
18 0.4
19 0.42
20 0.44
21 0.42
22 0.42
23 0.4
24 0.38
25 0.3
26 0.22
27 0.16
28 0.13
29 0.13
30 0.1
31 0.08
32 0.06
33 0.08
34 0.1
35 0.1
36 0.11
37 0.11
38 0.11
39 0.13
40 0.14
41 0.14
42 0.12
43 0.12
44 0.15
45 0.14
46 0.16
47 0.15
48 0.16
49 0.14
50 0.13
51 0.12
52 0.09
53 0.08
54 0.07
55 0.1
56 0.08
57 0.09
58 0.09
59 0.09
60 0.09
61 0.11
62 0.14
63 0.1
64 0.1
65 0.11
66 0.11
67 0.12
68 0.12
69 0.13
70 0.17
71 0.23
72 0.28
73 0.35
74 0.38
75 0.39
76 0.42
77 0.46
78 0.4
79 0.39
80 0.42
81 0.38
82 0.44
83 0.44
84 0.42
85 0.37
86 0.38
87 0.33
88 0.26
89 0.26
90 0.26
91 0.25
92 0.27
93 0.28
94 0.28
95 0.28
96 0.27
97 0.25
98 0.17
99 0.16
100 0.13
101 0.12
102 0.11
103 0.11
104 0.14
105 0.12
106 0.12
107 0.15
108 0.16
109 0.2
110 0.27
111 0.31
112 0.31
113 0.36
114 0.38
115 0.44
116 0.47
117 0.51
118 0.49
119 0.54
120 0.56
121 0.57
122 0.61
123 0.56
124 0.58
125 0.53
126 0.53
127 0.47
128 0.53
129 0.47
130 0.43
131 0.4
132 0.37
133 0.33
134 0.3
135 0.27
136 0.19
137 0.18
138 0.23
139 0.25
140 0.27
141 0.31
142 0.31
143 0.35
144 0.36
145 0.39
146 0.38
147 0.44
148 0.44
149 0.5
150 0.54
151 0.5
152 0.5
153 0.49
154 0.49
155 0.49
156 0.5
157 0.51
158 0.54
159 0.63
160 0.71
161 0.78
162 0.83
163 0.84
164 0.86
165 0.85
166 0.87
167 0.85
168 0.82
169 0.75
170 0.67
171 0.57
172 0.5
173 0.41
174 0.32
175 0.24
176 0.16
177 0.12