Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7W5S3

Protein Details
Accession S7W5S3   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
103-129DIRLDKKYRAKESKRSFKKFNTKEKVLHydrophilic
NLS Segment(s)
PositionSequence
111-120RAKESKRSFK
Subcellular Location(s) nucl 15, cyto_nucl 13, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000915  60S_ribosomal_L6E  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Amino Acid Sequences MQSERQQRLNISNIKNYYTADDIPAFAEKLLELHKPAPIELRTDLVQGNVVVVLEGEYASYRVVYLSRTEDNKALCMGLPSINGIGLFEIDERFLLRTSIVLDIRLDKKYRAKESKRSFKKFNTKEKVLTKEENDIEELLLKEIENEKFMKKYFETPYEINNTVDFYEINH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.48
3 0.43
4 0.38
5 0.33
6 0.28
7 0.24
8 0.22
9 0.2
10 0.2
11 0.2
12 0.17
13 0.13
14 0.13
15 0.09
16 0.1
17 0.12
18 0.12
19 0.13
20 0.14
21 0.16
22 0.16
23 0.17
24 0.21
25 0.2
26 0.22
27 0.2
28 0.22
29 0.2
30 0.21
31 0.21
32 0.15
33 0.15
34 0.12
35 0.11
36 0.08
37 0.07
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.06
52 0.07
53 0.11
54 0.14
55 0.16
56 0.18
57 0.2
58 0.2
59 0.2
60 0.18
61 0.15
62 0.12
63 0.1
64 0.1
65 0.08
66 0.08
67 0.07
68 0.07
69 0.07
70 0.06
71 0.06
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.06
86 0.1
87 0.1
88 0.1
89 0.1
90 0.14
91 0.17
92 0.2
93 0.19
94 0.19
95 0.25
96 0.32
97 0.41
98 0.48
99 0.52
100 0.6
101 0.7
102 0.78
103 0.82
104 0.82
105 0.79
106 0.79
107 0.83
108 0.81
109 0.82
110 0.8
111 0.75
112 0.76
113 0.77
114 0.74
115 0.69
116 0.65
117 0.56
118 0.55
119 0.52
120 0.45
121 0.39
122 0.32
123 0.26
124 0.23
125 0.21
126 0.14
127 0.12
128 0.1
129 0.11
130 0.15
131 0.16
132 0.16
133 0.17
134 0.19
135 0.22
136 0.24
137 0.27
138 0.25
139 0.32
140 0.37
141 0.41
142 0.44
143 0.43
144 0.48
145 0.5
146 0.5
147 0.43
148 0.36
149 0.32
150 0.26
151 0.25