Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7XFW8

Protein Details
Accession S7XFW8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPKLNRHKASRLDKKIKQKKLIEKPLGFHydrophilic
NLS Segment(s)
PositionSequence
6-20RHKASRLDKKIKQKK
Subcellular Location(s) cyto 13, mito 9, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR013025  Ribosomal_L25/23  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00276  Ribosomal_L23  
Amino Acid Sequences MPKLNRHKASRLDKKIKQKKLIEKPLGFSSLDIIKYGIGHEGAAKLIEEAGTLTFVVDQRADKINVKKAFEEIYGEKVKKVNINNTMKGVKKAYIRLVELGNAAVVATKAGIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.88
4 0.86
5 0.85
6 0.85
7 0.85
8 0.88
9 0.87
10 0.79
11 0.74
12 0.68
13 0.61
14 0.5
15 0.39
16 0.31
17 0.25
18 0.22
19 0.18
20 0.14
21 0.12
22 0.12
23 0.12
24 0.1
25 0.07
26 0.06
27 0.07
28 0.07
29 0.07
30 0.07
31 0.06
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.05
44 0.06
45 0.06
46 0.08
47 0.1
48 0.12
49 0.16
50 0.2
51 0.28
52 0.31
53 0.32
54 0.31
55 0.3
56 0.3
57 0.26
58 0.26
59 0.19
60 0.22
61 0.25
62 0.25
63 0.25
64 0.25
65 0.26
66 0.27
67 0.3
68 0.32
69 0.37
70 0.44
71 0.45
72 0.49
73 0.52
74 0.49
75 0.48
76 0.42
77 0.37
78 0.35
79 0.37
80 0.4
81 0.4
82 0.4
83 0.39
84 0.38
85 0.35
86 0.31
87 0.26
88 0.18
89 0.13
90 0.11
91 0.08
92 0.07
93 0.05