Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7W803

Protein Details
Accession S7W803    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
31-54REIKSLWKKERNRLAAKKSREKKABasic
NLS Segment(s)
PositionSequence
37-54WKKERNRLAAKKSREKKA
Subcellular Location(s) nucl 24, mito 1, cyto 1, pero 1, cyto_mito 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd14686  bZIP  
Amino Acid Sequences PSYMMSRNNINDNYNRNYFYYNEYENNVDSREIKSLWKKERNRLAAKKSREKKAVQLKELEEREKRLVEDIDIMKECTKDYDNILNELMIYIEKVMNGNCGKDNLVELFEALAKLKKPGTDYFIVDIAGIGDMALLVNNQRIEVISRKIKRYLNDMWYRNMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.44
3 0.38
4 0.38
5 0.35
6 0.35
7 0.34
8 0.32
9 0.3
10 0.31
11 0.31
12 0.3
13 0.3
14 0.26
15 0.21
16 0.18
17 0.17
18 0.18
19 0.17
20 0.22
21 0.29
22 0.37
23 0.45
24 0.54
25 0.59
26 0.66
27 0.75
28 0.78
29 0.79
30 0.8
31 0.8
32 0.79
33 0.82
34 0.83
35 0.81
36 0.8
37 0.76
38 0.69
39 0.68
40 0.7
41 0.69
42 0.62
43 0.6
44 0.53
45 0.56
46 0.56
47 0.52
48 0.42
49 0.38
50 0.37
51 0.32
52 0.3
53 0.24
54 0.21
55 0.17
56 0.21
57 0.18
58 0.18
59 0.17
60 0.18
61 0.16
62 0.16
63 0.15
64 0.11
65 0.11
66 0.09
67 0.11
68 0.17
69 0.17
70 0.18
71 0.19
72 0.17
73 0.15
74 0.14
75 0.12
76 0.05
77 0.05
78 0.04
79 0.04
80 0.04
81 0.05
82 0.05
83 0.1
84 0.1
85 0.11
86 0.12
87 0.12
88 0.13
89 0.13
90 0.14
91 0.1
92 0.1
93 0.09
94 0.08
95 0.08
96 0.08
97 0.08
98 0.07
99 0.09
100 0.08
101 0.1
102 0.11
103 0.13
104 0.16
105 0.19
106 0.23
107 0.25
108 0.27
109 0.27
110 0.27
111 0.25
112 0.21
113 0.18
114 0.13
115 0.1
116 0.07
117 0.04
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.04
124 0.07
125 0.07
126 0.07
127 0.08
128 0.09
129 0.12
130 0.17
131 0.24
132 0.31
133 0.37
134 0.42
135 0.49
136 0.52
137 0.52
138 0.55
139 0.56
140 0.57
141 0.61
142 0.6