Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7W4Z8

Protein Details
Accession S7W4Z8    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-32NFLTSSPKKTFKKCIKKYTVSQLLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 9, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR040260  RFA2-like  
Amino Acid Sequences NNLPMDSNFLTSSPKKTFKKCIKKYTVSQLLSTNEDTSIIQLVGWVRDVKNLSNGTVFILEDSNNIECAYWPSNPLDDINSGLIEVNSILMVTGTLRNFNNKKSITVTNIQKINDSNFMFYHYLSVIKQNTKKDFIEEPTKNHNNIKDDILQCYRNNQDANGLHLDIVINMLKNKYKEEDIIFISFNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.52
4 0.62
5 0.67
6 0.76
7 0.79
8 0.83
9 0.83
10 0.85
11 0.86
12 0.86
13 0.85
14 0.76
15 0.68
16 0.62
17 0.55
18 0.5
19 0.44
20 0.34
21 0.23
22 0.22
23 0.2
24 0.15
25 0.13
26 0.1
27 0.08
28 0.09
29 0.1
30 0.09
31 0.11
32 0.12
33 0.1
34 0.15
35 0.16
36 0.16
37 0.22
38 0.22
39 0.21
40 0.2
41 0.2
42 0.17
43 0.17
44 0.16
45 0.1
46 0.09
47 0.08
48 0.08
49 0.1
50 0.09
51 0.08
52 0.08
53 0.08
54 0.07
55 0.11
56 0.13
57 0.11
58 0.12
59 0.12
60 0.13
61 0.14
62 0.14
63 0.12
64 0.1
65 0.11
66 0.1
67 0.09
68 0.08
69 0.08
70 0.07
71 0.06
72 0.05
73 0.04
74 0.03
75 0.03
76 0.03
77 0.02
78 0.02
79 0.03
80 0.05
81 0.05
82 0.08
83 0.08
84 0.15
85 0.16
86 0.18
87 0.25
88 0.23
89 0.25
90 0.27
91 0.29
92 0.27
93 0.33
94 0.36
95 0.35
96 0.38
97 0.36
98 0.34
99 0.32
100 0.3
101 0.29
102 0.25
103 0.21
104 0.18
105 0.21
106 0.2
107 0.19
108 0.18
109 0.12
110 0.13
111 0.12
112 0.17
113 0.17
114 0.23
115 0.28
116 0.33
117 0.37
118 0.4
119 0.41
120 0.4
121 0.4
122 0.39
123 0.45
124 0.41
125 0.42
126 0.47
127 0.51
128 0.49
129 0.49
130 0.49
131 0.43
132 0.42
133 0.42
134 0.39
135 0.37
136 0.4
137 0.4
138 0.39
139 0.35
140 0.39
141 0.38
142 0.36
143 0.35
144 0.3
145 0.34
146 0.31
147 0.35
148 0.33
149 0.3
150 0.24
151 0.23
152 0.23
153 0.14
154 0.15
155 0.12
156 0.09
157 0.11
158 0.14
159 0.18
160 0.19
161 0.23
162 0.25
163 0.27
164 0.31
165 0.34
166 0.37
167 0.36
168 0.37