Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7W502

Protein Details
Accession S7W502    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-42KILNNKKYYFLREKKRRYSDQFKDPLFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031509  Mei5-like  
Pfam View protein in Pfam  
PF17021  Mei5_like  
Amino Acid Sequences MFYTSPPNNTNNYHIKILNNKKYYFLREKKRRYSDQFKDPLFIKKDIFKKLKMIEKLYEENKNMEEEIEKWKECINNCIIMLIDSYDHNGKDIFKALNLKKYGFDIKDYCNESEEEEDNKDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.49
4 0.57
5 0.59
6 0.57
7 0.53
8 0.55
9 0.58
10 0.61
11 0.61
12 0.6
13 0.62
14 0.66
15 0.76
16 0.8
17 0.85
18 0.86
19 0.84
20 0.86
21 0.83
22 0.83
23 0.81
24 0.71
25 0.65
26 0.58
27 0.56
28 0.5
29 0.43
30 0.34
31 0.33
32 0.38
33 0.44
34 0.45
35 0.39
36 0.41
37 0.45
38 0.51
39 0.48
40 0.45
41 0.4
42 0.41
43 0.44
44 0.42
45 0.4
46 0.34
47 0.31
48 0.28
49 0.25
50 0.21
51 0.16
52 0.13
53 0.1
54 0.16
55 0.18
56 0.17
57 0.17
58 0.19
59 0.22
60 0.21
61 0.25
62 0.21
63 0.21
64 0.21
65 0.21
66 0.19
67 0.16
68 0.16
69 0.11
70 0.09
71 0.06
72 0.08
73 0.1
74 0.1
75 0.1
76 0.1
77 0.11
78 0.12
79 0.15
80 0.14
81 0.15
82 0.24
83 0.26
84 0.34
85 0.35
86 0.35
87 0.32
88 0.36
89 0.41
90 0.33
91 0.36
92 0.32
93 0.35
94 0.42
95 0.44
96 0.41
97 0.35
98 0.34
99 0.31
100 0.31
101 0.3
102 0.25