Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7W9P6

Protein Details
Accession S7W9P6    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-87TVLGRFRKNRNENKKNENHNKTSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR040598  NIP7_N  
IPR002478  PUA  
IPR015947  PUA-like_sf  
IPR036974  PUA_sf  
IPR016686  Ribosomal_synth_fac_NIP7  
IPR005155  UPF0113_PUA  
Gene Ontology GO:0005730  C:nucleolus  
GO:0003723  F:RNA binding  
GO:0042255  P:ribosome assembly  
Pfam View protein in Pfam  
PF03657  UPF0113  
PF17833  UPF0113_N  
PROSITE View protein in PROSITE  
PS50890  PUA  
CDD cd21151  PUA_Nip7-like  
Amino Acid Sequences MRNLTDRELQTFINKAKLFIGDNISEIINENTSLAMNKKDLILFKKELEKKSSNIPKSKIIFLGTVLGRFRKNRNENKKNENHNKTSRFEFDITALSILSKYAINKVYIKKSAEMNVLYGNNVLKSHLYKIPENLEQKAAVVLYNTYNVPLGFGITSKSSASLTVAGGSSMAIIRQGDAGDYLRRETEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.3
4 0.32
5 0.3
6 0.28
7 0.31
8 0.23
9 0.23
10 0.23
11 0.21
12 0.18
13 0.18
14 0.15
15 0.11
16 0.1
17 0.09
18 0.08
19 0.08
20 0.1
21 0.1
22 0.11
23 0.11
24 0.12
25 0.13
26 0.15
27 0.19
28 0.22
29 0.27
30 0.27
31 0.29
32 0.38
33 0.43
34 0.45
35 0.48
36 0.47
37 0.42
38 0.5
39 0.57
40 0.54
41 0.55
42 0.54
43 0.55
44 0.55
45 0.56
46 0.47
47 0.4
48 0.33
49 0.27
50 0.29
51 0.21
52 0.2
53 0.19
54 0.19
55 0.19
56 0.21
57 0.25
58 0.3
59 0.39
60 0.47
61 0.58
62 0.66
63 0.7
64 0.78
65 0.82
66 0.82
67 0.84
68 0.8
69 0.77
70 0.75
71 0.73
72 0.66
73 0.6
74 0.52
75 0.45
76 0.39
77 0.32
78 0.24
79 0.21
80 0.19
81 0.15
82 0.12
83 0.09
84 0.07
85 0.06
86 0.06
87 0.05
88 0.05
89 0.09
90 0.1
91 0.12
92 0.17
93 0.21
94 0.25
95 0.29
96 0.3
97 0.29
98 0.3
99 0.31
100 0.31
101 0.27
102 0.23
103 0.22
104 0.21
105 0.19
106 0.17
107 0.14
108 0.11
109 0.11
110 0.1
111 0.08
112 0.1
113 0.13
114 0.15
115 0.18
116 0.19
117 0.23
118 0.27
119 0.32
120 0.34
121 0.32
122 0.31
123 0.27
124 0.26
125 0.23
126 0.18
127 0.12
128 0.1
129 0.09
130 0.08
131 0.1
132 0.1
133 0.09
134 0.1
135 0.1
136 0.1
137 0.09
138 0.09
139 0.07
140 0.08
141 0.09
142 0.09
143 0.11
144 0.1
145 0.11
146 0.1
147 0.11
148 0.12
149 0.12
150 0.11
151 0.12
152 0.12
153 0.1
154 0.1
155 0.09
156 0.09
157 0.07
158 0.07
159 0.06
160 0.06
161 0.07
162 0.08
163 0.09
164 0.08
165 0.1
166 0.13
167 0.16
168 0.17
169 0.18