Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7W5Q1

Protein Details
Accession S7W5Q1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
24-52NLGVLKKSFNCKKCKKRMNLVAVKKNDRYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 13, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MTMNRRQLNSVIYSPCKTVEYLQNLGVLKKSFNCKKCKKRMNLVAVKKNDRYIWKCMINKCKKQTISIRKGSVFYKVKIELSKILEVIYELIQKKDLKEININYKGVNTIMNYFNSKIMEINNNKIGGYNKWVEVDESAVARRKYNVGRLVRTIWIVGGIERGSVNMFFRITKSRNSDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.33
4 0.29
5 0.28
6 0.3
7 0.32
8 0.33
9 0.33
10 0.36
11 0.36
12 0.35
13 0.33
14 0.26
15 0.21
16 0.23
17 0.31
18 0.35
19 0.41
20 0.51
21 0.59
22 0.69
23 0.78
24 0.84
25 0.84
26 0.86
27 0.89
28 0.89
29 0.89
30 0.88
31 0.86
32 0.84
33 0.8
34 0.71
35 0.65
36 0.57
37 0.55
38 0.49
39 0.46
40 0.46
41 0.48
42 0.51
43 0.56
44 0.63
45 0.64
46 0.69
47 0.68
48 0.7
49 0.63
50 0.65
51 0.68
52 0.68
53 0.67
54 0.66
55 0.64
56 0.57
57 0.58
58 0.51
59 0.5
60 0.42
61 0.34
62 0.31
63 0.29
64 0.3
65 0.28
66 0.29
67 0.24
68 0.24
69 0.24
70 0.19
71 0.17
72 0.15
73 0.14
74 0.14
75 0.1
76 0.11
77 0.1
78 0.1
79 0.13
80 0.13
81 0.14
82 0.19
83 0.2
84 0.18
85 0.24
86 0.28
87 0.34
88 0.38
89 0.38
90 0.32
91 0.31
92 0.29
93 0.23
94 0.21
95 0.12
96 0.11
97 0.13
98 0.14
99 0.16
100 0.16
101 0.17
102 0.16
103 0.16
104 0.13
105 0.14
106 0.21
107 0.21
108 0.25
109 0.27
110 0.27
111 0.27
112 0.28
113 0.28
114 0.21
115 0.24
116 0.21
117 0.19
118 0.2
119 0.2
120 0.19
121 0.17
122 0.17
123 0.14
124 0.13
125 0.14
126 0.18
127 0.19
128 0.19
129 0.2
130 0.24
131 0.27
132 0.34
133 0.4
134 0.41
135 0.45
136 0.48
137 0.5
138 0.46
139 0.43
140 0.36
141 0.27
142 0.22
143 0.17
144 0.14
145 0.13
146 0.11
147 0.11
148 0.11
149 0.11
150 0.11
151 0.11
152 0.13
153 0.12
154 0.13
155 0.13
156 0.16
157 0.24
158 0.26
159 0.33