Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7W9L6

Protein Details
Accession S7W9L6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
88-108NKTEEVGKRRKPMKEKNINKKBasic
NLS Segment(s)
PositionSequence
94-108GKRRKPMKEKNINKK
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MQYLNIYLSLYLCNNMEEKNKKLAKKNTQLKSELRSKAIENNKTIEKNIKGNYYNDLTKDKMCLFLDESIQVLEELLNKTKIYKENINKTEEVGKRRKPMKEKNINKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.23
4 0.26
5 0.29
6 0.37
7 0.43
8 0.47
9 0.56
10 0.63
11 0.65
12 0.71
13 0.77
14 0.75
15 0.75
16 0.75
17 0.7
18 0.66
19 0.65
20 0.58
21 0.5
22 0.44
23 0.39
24 0.42
25 0.47
26 0.45
27 0.38
28 0.37
29 0.4
30 0.39
31 0.38
32 0.36
33 0.3
34 0.3
35 0.31
36 0.32
37 0.3
38 0.3
39 0.32
40 0.29
41 0.27
42 0.24
43 0.24
44 0.2
45 0.18
46 0.2
47 0.17
48 0.18
49 0.18
50 0.17
51 0.17
52 0.17
53 0.18
54 0.16
55 0.16
56 0.11
57 0.11
58 0.09
59 0.07
60 0.06
61 0.08
62 0.09
63 0.11
64 0.12
65 0.12
66 0.13
67 0.18
68 0.23
69 0.26
70 0.34
71 0.41
72 0.51
73 0.56
74 0.59
75 0.55
76 0.53
77 0.56
78 0.52
79 0.51
80 0.49
81 0.51
82 0.56
83 0.63
84 0.7
85 0.71
86 0.77
87 0.8
88 0.82