Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7W595

Protein Details
Accession S7W595    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
49-70KLWKLLCYRYRNKNDNNNSNNKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001094  Flavdoxin-like  
IPR008254  Flavodoxin/NO_synth  
IPR029039  Flavoprotein-like_sf  
Gene Ontology GO:0010181  F:FMN binding  
Pfam View protein in Pfam  
PF00258  Flavodoxin_1  
PROSITE View protein in PROSITE  
PS50902  FLAVODOXIN_LIKE  
Amino Acid Sequences NDNKYTNNGIVSFSVDIEDINIINIFKYKYVLFVCSTAGDGDIPYSMNKLWKLLCYRYRNKNDNNNSNNKDSKCNVSNSKSNNNNNYQHNNNNIIVNNNDNLFVNLHYAVFGLGDSSFSKYNYASKKLYNILKRLDVNMVLERGEGDDQDRNGYKDGLDPWIEELINNLKKLITEERNIDSSDRDECNSIDNGDRDKDNSDKKEGRDEYNNIDKKNMIKNKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.12
4 0.11
5 0.11
6 0.08
7 0.08
8 0.08
9 0.08
10 0.08
11 0.11
12 0.11
13 0.1
14 0.13
15 0.12
16 0.16
17 0.18
18 0.21
19 0.2
20 0.2
21 0.21
22 0.19
23 0.2
24 0.15
25 0.14
26 0.11
27 0.09
28 0.08
29 0.07
30 0.07
31 0.07
32 0.08
33 0.08
34 0.12
35 0.13
36 0.15
37 0.16
38 0.2
39 0.26
40 0.33
41 0.41
42 0.46
43 0.55
44 0.63
45 0.71
46 0.74
47 0.77
48 0.79
49 0.81
50 0.82
51 0.8
52 0.8
53 0.74
54 0.72
55 0.7
56 0.61
57 0.56
58 0.48
59 0.47
60 0.41
61 0.43
62 0.43
63 0.42
64 0.46
65 0.46
66 0.54
67 0.55
68 0.58
69 0.58
70 0.59
71 0.59
72 0.59
73 0.59
74 0.54
75 0.49
76 0.47
77 0.45
78 0.39
79 0.35
80 0.3
81 0.26
82 0.22
83 0.2
84 0.16
85 0.13
86 0.12
87 0.1
88 0.1
89 0.09
90 0.08
91 0.08
92 0.07
93 0.07
94 0.07
95 0.06
96 0.06
97 0.05
98 0.04
99 0.04
100 0.03
101 0.04
102 0.05
103 0.06
104 0.07
105 0.07
106 0.08
107 0.08
108 0.15
109 0.18
110 0.22
111 0.23
112 0.23
113 0.27
114 0.32
115 0.38
116 0.38
117 0.38
118 0.36
119 0.39
120 0.39
121 0.37
122 0.32
123 0.27
124 0.24
125 0.21
126 0.19
127 0.14
128 0.13
129 0.11
130 0.11
131 0.1
132 0.08
133 0.08
134 0.1
135 0.1
136 0.14
137 0.15
138 0.15
139 0.16
140 0.17
141 0.15
142 0.15
143 0.17
144 0.17
145 0.16
146 0.15
147 0.16
148 0.18
149 0.18
150 0.14
151 0.15
152 0.2
153 0.22
154 0.22
155 0.21
156 0.19
157 0.19
158 0.23
159 0.29
160 0.25
161 0.26
162 0.3
163 0.33
164 0.35
165 0.36
166 0.33
167 0.26
168 0.24
169 0.25
170 0.22
171 0.2
172 0.2
173 0.19
174 0.22
175 0.21
176 0.21
177 0.2
178 0.21
179 0.24
180 0.25
181 0.26
182 0.24
183 0.26
184 0.32
185 0.36
186 0.38
187 0.44
188 0.47
189 0.49
190 0.58
191 0.58
192 0.58
193 0.57
194 0.57
195 0.56
196 0.61
197 0.63
198 0.54
199 0.52
200 0.48
201 0.45
202 0.52