Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7WA98

Protein Details
Accession S7WA98    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MFKRIKLKRLKKDKEKQPYISKTISHydrophilic
NLS Segment(s)
PositionSequence
4-15RIKLKRLKKDKE
Subcellular Location(s) mito 13, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MFKRIKLKRLKKDKEKQPYISKTISNTFKDKPQPTTELDIIKQQLSNPFKISSALSYLQKNPLFIKENIYFSLNSVMPMILNRNYNKNSYKKIIQVIKMICRNENFYKIEDIAFNYFLSIILSDIECRDEDITSLFIRYCRNSIIKNKNVLINAGKKELLDKCYKNNIDDKFRIYSGKNDMVIKYNENIFLGYNYVYNRNKYFYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.91
4 0.9
5 0.87
6 0.82
7 0.77
8 0.69
9 0.63
10 0.61
11 0.6
12 0.53
13 0.5
14 0.47
15 0.5
16 0.56
17 0.56
18 0.54
19 0.52
20 0.52
21 0.5
22 0.54
23 0.5
24 0.45
25 0.41
26 0.4
27 0.36
28 0.33
29 0.29
30 0.24
31 0.29
32 0.29
33 0.3
34 0.28
35 0.27
36 0.26
37 0.27
38 0.26
39 0.18
40 0.19
41 0.2
42 0.2
43 0.22
44 0.24
45 0.3
46 0.3
47 0.3
48 0.27
49 0.29
50 0.31
51 0.29
52 0.33
53 0.29
54 0.31
55 0.31
56 0.31
57 0.25
58 0.21
59 0.25
60 0.18
61 0.15
62 0.13
63 0.12
64 0.1
65 0.1
66 0.12
67 0.1
68 0.14
69 0.15
70 0.21
71 0.22
72 0.27
73 0.32
74 0.34
75 0.36
76 0.37
77 0.39
78 0.38
79 0.43
80 0.44
81 0.41
82 0.42
83 0.4
84 0.42
85 0.43
86 0.4
87 0.35
88 0.3
89 0.33
90 0.29
91 0.31
92 0.26
93 0.23
94 0.24
95 0.22
96 0.22
97 0.17
98 0.17
99 0.13
100 0.12
101 0.11
102 0.09
103 0.09
104 0.08
105 0.08
106 0.06
107 0.05
108 0.04
109 0.05
110 0.05
111 0.05
112 0.06
113 0.06
114 0.07
115 0.07
116 0.07
117 0.07
118 0.08
119 0.09
120 0.08
121 0.09
122 0.08
123 0.1
124 0.12
125 0.13
126 0.14
127 0.16
128 0.19
129 0.25
130 0.34
131 0.43
132 0.47
133 0.52
134 0.52
135 0.53
136 0.5
137 0.47
138 0.43
139 0.4
140 0.36
141 0.33
142 0.31
143 0.27
144 0.31
145 0.32
146 0.31
147 0.32
148 0.32
149 0.36
150 0.45
151 0.47
152 0.46
153 0.49
154 0.51
155 0.52
156 0.53
157 0.5
158 0.44
159 0.44
160 0.44
161 0.39
162 0.38
163 0.37
164 0.4
165 0.39
166 0.38
167 0.38
168 0.4
169 0.41
170 0.37
171 0.33
172 0.29
173 0.27
174 0.25
175 0.24
176 0.19
177 0.18
178 0.17
179 0.14
180 0.14
181 0.15
182 0.23
183 0.26
184 0.3
185 0.32