Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7W952

Protein Details
Accession S7W952   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
154-173DEEKKAIKHKREFRNKEFFDBasic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 12, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR001406  PsdUridine_synth_TruA  
IPR020097  PsdUridine_synth_TruA_a/b_dom  
IPR020095  PsdUridine_synth_TruA_C  
IPR020094  TruA/RsuA/RluB/E/F_N  
Gene Ontology GO:0003723  F:RNA binding  
GO:0106029  F:tRNA pseudouridine synthase activity  
GO:0001522  P:pseudouridine synthesis  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01416  PseudoU_synth_1  
Amino Acid Sequences MKIKVALIIGYDGTNYHGLQYSVNVKTIEEVILKNLIKLQAIKKENHDVRKAGFQRACRTDKGVHAVYNVVVCKIECDIDKIFIPLKQELEKKNIFLYKMVKVPKSWVAKNRVDYRIYEYFIPKFILKKKASINLETINNAMNIIKERNENRTDEEKKAIKHKREFRNKEFFDAITFKETEIDIDRINNLIKNFLGSKDYHNFTINKNEKGTHRHIMEITTEESDDYIKLIIKGQSFLLHQIRKMVGALLIAYIFENENIFDIAFKKKKINIPKTPSKFLLLKFPSFEFYNKKYTTTHEPIEIEETKNIEELIYNRIKDTKNLETFDEWLKTVIEYFYEFTYLIENNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.12
4 0.14
5 0.14
6 0.14
7 0.19
8 0.24
9 0.23
10 0.27
11 0.25
12 0.23
13 0.24
14 0.25
15 0.24
16 0.18
17 0.17
18 0.16
19 0.23
20 0.23
21 0.22
22 0.24
23 0.23
24 0.23
25 0.27
26 0.31
27 0.33
28 0.38
29 0.41
30 0.43
31 0.53
32 0.58
33 0.61
34 0.6
35 0.53
36 0.52
37 0.59
38 0.57
39 0.55
40 0.52
41 0.5
42 0.54
43 0.59
44 0.6
45 0.52
46 0.53
47 0.48
48 0.5
49 0.51
50 0.45
51 0.38
52 0.35
53 0.34
54 0.3
55 0.29
56 0.24
57 0.17
58 0.14
59 0.12
60 0.12
61 0.12
62 0.13
63 0.1
64 0.14
65 0.15
66 0.16
67 0.17
68 0.18
69 0.19
70 0.18
71 0.21
72 0.19
73 0.21
74 0.25
75 0.3
76 0.32
77 0.38
78 0.38
79 0.36
80 0.39
81 0.39
82 0.34
83 0.32
84 0.33
85 0.3
86 0.34
87 0.37
88 0.34
89 0.31
90 0.34
91 0.38
92 0.41
93 0.42
94 0.44
95 0.47
96 0.51
97 0.58
98 0.63
99 0.6
100 0.54
101 0.5
102 0.5
103 0.46
104 0.41
105 0.36
106 0.31
107 0.27
108 0.27
109 0.27
110 0.21
111 0.22
112 0.26
113 0.34
114 0.32
115 0.36
116 0.4
117 0.46
118 0.48
119 0.46
120 0.43
121 0.38
122 0.39
123 0.34
124 0.29
125 0.22
126 0.19
127 0.16
128 0.12
129 0.08
130 0.09
131 0.09
132 0.1
133 0.14
134 0.16
135 0.22
136 0.24
137 0.25
138 0.28
139 0.37
140 0.39
141 0.37
142 0.41
143 0.38
144 0.38
145 0.47
146 0.49
147 0.48
148 0.53
149 0.6
150 0.64
151 0.72
152 0.78
153 0.76
154 0.8
155 0.73
156 0.68
157 0.6
158 0.5
159 0.42
160 0.35
161 0.28
162 0.19
163 0.19
164 0.14
165 0.14
166 0.14
167 0.11
168 0.12
169 0.12
170 0.1
171 0.1
172 0.1
173 0.1
174 0.11
175 0.12
176 0.09
177 0.09
178 0.09
179 0.1
180 0.1
181 0.1
182 0.12
183 0.11
184 0.16
185 0.2
186 0.22
187 0.22
188 0.24
189 0.25
190 0.24
191 0.34
192 0.34
193 0.32
194 0.32
195 0.33
196 0.33
197 0.39
198 0.43
199 0.38
200 0.35
201 0.34
202 0.34
203 0.32
204 0.3
205 0.26
206 0.21
207 0.15
208 0.14
209 0.12
210 0.11
211 0.1
212 0.09
213 0.07
214 0.06
215 0.06
216 0.07
217 0.1
218 0.13
219 0.13
220 0.14
221 0.14
222 0.16
223 0.16
224 0.21
225 0.26
226 0.24
227 0.24
228 0.27
229 0.27
230 0.25
231 0.25
232 0.2
233 0.13
234 0.12
235 0.11
236 0.08
237 0.07
238 0.06
239 0.06
240 0.06
241 0.05
242 0.05
243 0.05
244 0.05
245 0.06
246 0.06
247 0.06
248 0.06
249 0.08
250 0.17
251 0.2
252 0.22
253 0.26
254 0.31
255 0.39
256 0.5
257 0.58
258 0.6
259 0.66
260 0.76
261 0.78
262 0.78
263 0.73
264 0.67
265 0.61
266 0.52
267 0.54
268 0.47
269 0.43
270 0.39
271 0.38
272 0.36
273 0.33
274 0.36
275 0.33
276 0.32
277 0.39
278 0.37
279 0.38
280 0.36
281 0.4
282 0.46
283 0.45
284 0.44
285 0.41
286 0.4
287 0.4
288 0.45
289 0.42
290 0.35
291 0.3
292 0.29
293 0.23
294 0.23
295 0.21
296 0.15
297 0.14
298 0.13
299 0.19
300 0.24
301 0.23
302 0.24
303 0.31
304 0.32
305 0.34
306 0.4
307 0.42
308 0.43
309 0.45
310 0.48
311 0.44
312 0.46
313 0.46
314 0.42
315 0.32
316 0.26
317 0.24
318 0.21
319 0.2
320 0.18
321 0.13
322 0.13
323 0.15
324 0.14
325 0.15
326 0.15
327 0.13
328 0.16