Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7W7J3

Protein Details
Accession S7W7J3    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-34ITYSRCNKCIPCKNYNNRFISHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Amino Acid Sequences FRSQESVYSIKNITYSRCNKCIPCKNYNNRFISHTDNNNITIDNINGNLTYSNPRNNNININNTDISIINNNTDYTCIENRIKISADIYAKSPNGNGGIFKALYKLYLEEYNNSNNNDIKDNNNNDSNNKDNNTTTNNNVNNEIHLKDIKYFNVSAVDNVLSNIIDPLAIGISIDKGLDILSKGIKLEDDRGQFYIYNNNNNNNDKCDNNNNTVKCDNNTVKNNNNNNDNTNFDANNNTSTNQIKNKIRILEYSEINDKNNINKYKDYKATGIANICDHY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.42
3 0.45
4 0.51
5 0.55
6 0.57
7 0.66
8 0.73
9 0.7
10 0.71
11 0.74
12 0.79
13 0.84
14 0.87
15 0.81
16 0.72
17 0.69
18 0.62
19 0.6
20 0.57
21 0.53
22 0.48
23 0.46
24 0.45
25 0.42
26 0.39
27 0.31
28 0.25
29 0.19
30 0.15
31 0.13
32 0.12
33 0.11
34 0.11
35 0.1
36 0.11
37 0.16
38 0.17
39 0.24
40 0.26
41 0.29
42 0.33
43 0.36
44 0.43
45 0.42
46 0.46
47 0.4
48 0.43
49 0.41
50 0.36
51 0.35
52 0.26
53 0.23
54 0.19
55 0.17
56 0.13
57 0.14
58 0.14
59 0.13
60 0.14
61 0.12
62 0.14
63 0.14
64 0.18
65 0.19
66 0.21
67 0.22
68 0.23
69 0.24
70 0.19
71 0.19
72 0.19
73 0.2
74 0.19
75 0.19
76 0.2
77 0.19
78 0.19
79 0.19
80 0.15
81 0.14
82 0.14
83 0.13
84 0.1
85 0.12
86 0.12
87 0.12
88 0.12
89 0.1
90 0.1
91 0.1
92 0.1
93 0.09
94 0.14
95 0.15
96 0.16
97 0.18
98 0.23
99 0.25
100 0.25
101 0.24
102 0.22
103 0.22
104 0.22
105 0.21
106 0.2
107 0.24
108 0.27
109 0.28
110 0.31
111 0.3
112 0.29
113 0.32
114 0.32
115 0.28
116 0.26
117 0.24
118 0.2
119 0.22
120 0.26
121 0.25
122 0.24
123 0.28
124 0.28
125 0.28
126 0.3
127 0.27
128 0.23
129 0.23
130 0.21
131 0.15
132 0.13
133 0.13
134 0.13
135 0.15
136 0.14
137 0.14
138 0.14
139 0.13
140 0.16
141 0.15
142 0.13
143 0.12
144 0.12
145 0.1
146 0.1
147 0.1
148 0.06
149 0.06
150 0.05
151 0.04
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.04
161 0.04
162 0.03
163 0.03
164 0.03
165 0.04
166 0.05
167 0.06
168 0.06
169 0.07
170 0.07
171 0.07
172 0.09
173 0.09
174 0.13
175 0.18
176 0.2
177 0.21
178 0.22
179 0.23
180 0.23
181 0.22
182 0.27
183 0.24
184 0.3
185 0.31
186 0.37
187 0.41
188 0.45
189 0.46
190 0.43
191 0.42
192 0.35
193 0.38
194 0.41
195 0.4
196 0.42
197 0.48
198 0.44
199 0.46
200 0.47
201 0.45
202 0.37
203 0.41
204 0.39
205 0.4
206 0.46
207 0.48
208 0.53
209 0.6
210 0.66
211 0.63
212 0.65
213 0.59
214 0.56
215 0.53
216 0.48
217 0.43
218 0.38
219 0.34
220 0.27
221 0.3
222 0.27
223 0.28
224 0.26
225 0.22
226 0.22
227 0.24
228 0.29
229 0.31
230 0.38
231 0.4
232 0.45
233 0.51
234 0.54
235 0.53
236 0.51
237 0.51
238 0.49
239 0.46
240 0.44
241 0.46
242 0.41
243 0.41
244 0.41
245 0.36
246 0.36
247 0.43
248 0.44
249 0.41
250 0.47
251 0.52
252 0.57
253 0.62
254 0.6
255 0.54
256 0.54
257 0.55
258 0.52
259 0.51
260 0.45