Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7WDE5

Protein Details
Accession S7WDE5    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-41LLTDKRKKLLLKKGDKGFKPVNRKGLRKRKTVRGSIIBasic
139-158LIEERKKKSEKERADFLKKYBasic
NLS Segment(s)
PositionSequence
9-35KRKKLLLKKGDKGFKPVNRKGLRKRKT
117-156PKLKVSRYQTEKQKERKAEKIKLIEERKKKSEKERADFLK
Subcellular Location(s) nucl 11, mito 10.5, cyto_mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MIKTLLTDKRKKLLLKKGDKGFKPVNRKGLRKRKTVRGSIIASDISMVCVSLIDAKEVAIEGLTDVVVGATHWPKRFNKLKAKAGFSEDADVTAEQVLKVIKDAILEVNGGDIKKLPKLKVSRYQTEKQKERKAEKIKLIEERKKKSEKERADFLKKYPDWQKKFATKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.73
3 0.77
4 0.8
5 0.82
6 0.77
7 0.75
8 0.74
9 0.72
10 0.72
11 0.69
12 0.7
13 0.69
14 0.77
15 0.8
16 0.81
17 0.8
18 0.8
19 0.82
20 0.82
21 0.83
22 0.82
23 0.78
24 0.75
25 0.71
26 0.62
27 0.56
28 0.46
29 0.36
30 0.28
31 0.21
32 0.14
33 0.1
34 0.08
35 0.05
36 0.05
37 0.05
38 0.08
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.04
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.05
57 0.07
58 0.11
59 0.12
60 0.16
61 0.17
62 0.26
63 0.34
64 0.4
65 0.48
66 0.54
67 0.62
68 0.63
69 0.66
70 0.59
71 0.55
72 0.48
73 0.38
74 0.32
75 0.22
76 0.18
77 0.14
78 0.12
79 0.09
80 0.08
81 0.08
82 0.05
83 0.06
84 0.06
85 0.05
86 0.06
87 0.06
88 0.05
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.06
95 0.07
96 0.08
97 0.07
98 0.07
99 0.08
100 0.09
101 0.14
102 0.18
103 0.18
104 0.24
105 0.3
106 0.38
107 0.46
108 0.53
109 0.57
110 0.61
111 0.68
112 0.71
113 0.75
114 0.76
115 0.76
116 0.78
117 0.78
118 0.77
119 0.79
120 0.8
121 0.78
122 0.78
123 0.76
124 0.73
125 0.74
126 0.77
127 0.76
128 0.76
129 0.75
130 0.75
131 0.75
132 0.75
133 0.76
134 0.76
135 0.78
136 0.76
137 0.78
138 0.79
139 0.81
140 0.77
141 0.7
142 0.7
143 0.6
144 0.61
145 0.61
146 0.62
147 0.59
148 0.63
149 0.69