Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7WA99

Protein Details
Accession S7WA99    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
171-202LKKLKEYIRNIPKRKPVKKYFNQKRNNYIAKIHydrophilic
NLS Segment(s)
PositionSequence
181-189IPKRKPVKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR015671  GSCR1_dom  
Pfam View protein in Pfam  
PF15249  GLTSCR1  
Amino Acid Sequences MIDYESLEENEKCLSIKNKSLNKKGSIKYINNENEEERAENKYEEIEAEIEHSDHSHIENKPSKHIQSLITRRDKILAFITKEQKQITNPDYRPFNNVKSAMENIYPYHIFHAKSHEDIAFLNSKDKDVRKYAEDTITNVYKFLEEEDNKEFNDYNTAVDIIMKEEEVYILKKLKEYIRNIPKRKPVKKYFNQKRNNYIAKIKLKENIENYIEDIQQKRKVKFNRKYLQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.33
4 0.42
5 0.5
6 0.59
7 0.68
8 0.7
9 0.72
10 0.76
11 0.72
12 0.72
13 0.73
14 0.69
15 0.65
16 0.68
17 0.66
18 0.6
19 0.59
20 0.51
21 0.44
22 0.4
23 0.36
24 0.28
25 0.25
26 0.23
27 0.2
28 0.19
29 0.17
30 0.16
31 0.14
32 0.14
33 0.11
34 0.09
35 0.11
36 0.11
37 0.1
38 0.1
39 0.1
40 0.08
41 0.08
42 0.1
43 0.14
44 0.15
45 0.23
46 0.3
47 0.31
48 0.38
49 0.43
50 0.42
51 0.39
52 0.41
53 0.38
54 0.42
55 0.5
56 0.52
57 0.55
58 0.54
59 0.51
60 0.52
61 0.47
62 0.39
63 0.37
64 0.33
65 0.29
66 0.35
67 0.41
68 0.4
69 0.43
70 0.41
71 0.37
72 0.33
73 0.36
74 0.34
75 0.36
76 0.34
77 0.36
78 0.4
79 0.38
80 0.42
81 0.38
82 0.37
83 0.33
84 0.33
85 0.29
86 0.27
87 0.28
88 0.24
89 0.21
90 0.19
91 0.14
92 0.15
93 0.14
94 0.12
95 0.13
96 0.14
97 0.14
98 0.14
99 0.2
100 0.18
101 0.19
102 0.2
103 0.18
104 0.16
105 0.15
106 0.16
107 0.14
108 0.13
109 0.16
110 0.14
111 0.15
112 0.18
113 0.2
114 0.21
115 0.21
116 0.24
117 0.23
118 0.27
119 0.29
120 0.31
121 0.3
122 0.28
123 0.29
124 0.29
125 0.26
126 0.22
127 0.19
128 0.14
129 0.13
130 0.13
131 0.17
132 0.15
133 0.18
134 0.23
135 0.25
136 0.24
137 0.25
138 0.24
139 0.16
140 0.2
141 0.17
142 0.13
143 0.12
144 0.12
145 0.11
146 0.11
147 0.11
148 0.08
149 0.08
150 0.07
151 0.06
152 0.06
153 0.07
154 0.08
155 0.09
156 0.1
157 0.14
158 0.14
159 0.16
160 0.2
161 0.27
162 0.33
163 0.38
164 0.46
165 0.53
166 0.63
167 0.67
168 0.72
169 0.74
170 0.77
171 0.81
172 0.8
173 0.8
174 0.81
175 0.85
176 0.88
177 0.9
178 0.89
179 0.91
180 0.88
181 0.87
182 0.86
183 0.83
184 0.77
185 0.74
186 0.73
187 0.72
188 0.68
189 0.62
190 0.59
191 0.56
192 0.57
193 0.53
194 0.51
195 0.44
196 0.41
197 0.4
198 0.37
199 0.34
200 0.32
201 0.33
202 0.32
203 0.38
204 0.45
205 0.45
206 0.51
207 0.6
208 0.67
209 0.72
210 0.77