Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7W4T1

Protein Details
Accession S7W4T1    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
136-156ISYIVKKSKNKAKLRYLNGSAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 12.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005314  Peptidase_C50  
Gene Ontology GO:0005634  C:nucleus  
GO:0004197  F:cysteine-type endopeptidase activity  
GO:0006508  P:proteolysis  
Amino Acid Sequences EVDNYVVITNTNNIKDINNTIINNCNINIFKSNSIVNNYLKYNNMVVGCLWDTTDKDLDNITEFIIHYISNNNKYVDSNNNRYIDSNNINNDIRDSDNTNNNIKDNNINKYDINNHINDNITYTNPRTNFNDNISISYIVKKSKNKAKLRYLNGSAMVVYGLPINIKYNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.26
4 0.27
5 0.27
6 0.27
7 0.28
8 0.33
9 0.33
10 0.32
11 0.28
12 0.27
13 0.22
14 0.24
15 0.26
16 0.22
17 0.22
18 0.23
19 0.25
20 0.24
21 0.28
22 0.29
23 0.27
24 0.28
25 0.28
26 0.28
27 0.27
28 0.26
29 0.22
30 0.21
31 0.19
32 0.16
33 0.14
34 0.15
35 0.14
36 0.12
37 0.12
38 0.1
39 0.1
40 0.12
41 0.14
42 0.11
43 0.11
44 0.12
45 0.12
46 0.13
47 0.12
48 0.1
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.06
55 0.1
56 0.13
57 0.16
58 0.18
59 0.18
60 0.18
61 0.19
62 0.21
63 0.26
64 0.29
65 0.32
66 0.36
67 0.37
68 0.36
69 0.36
70 0.35
71 0.31
72 0.28
73 0.25
74 0.2
75 0.22
76 0.22
77 0.21
78 0.21
79 0.17
80 0.15
81 0.13
82 0.16
83 0.15
84 0.21
85 0.24
86 0.26
87 0.25
88 0.25
89 0.24
90 0.22
91 0.26
92 0.24
93 0.27
94 0.26
95 0.27
96 0.27
97 0.29
98 0.33
99 0.32
100 0.31
101 0.27
102 0.26
103 0.26
104 0.27
105 0.24
106 0.22
107 0.17
108 0.15
109 0.16
110 0.17
111 0.21
112 0.21
113 0.24
114 0.26
115 0.31
116 0.33
117 0.34
118 0.4
119 0.35
120 0.36
121 0.36
122 0.33
123 0.28
124 0.29
125 0.27
126 0.24
127 0.3
128 0.33
129 0.4
130 0.48
131 0.57
132 0.62
133 0.7
134 0.76
135 0.79
136 0.82
137 0.82
138 0.78
139 0.72
140 0.65
141 0.56
142 0.44
143 0.35
144 0.27
145 0.17
146 0.13
147 0.08
148 0.07
149 0.07
150 0.08