Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7XPH9

Protein Details
Accession S7XPH9    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
114-143KNHTEKYMKKYTKNHLKNHTVKYRKKYKKKBasic
NLS Segment(s)
PositionSequence
131-144KNHTVKYRKKYKKK
Subcellular Location(s) nucl 16.5, cyto_nucl 12.833, cyto 8, cyto_pero 4.833
Family & Domain DBs
Amino Acid Sequences MNIQASNINACGEETNVEDVLIKIKKGNKPEIQANGIINNLDHNVKIKNIKAQCKIKTLEFSGVDVVVRKDMDYVYFSRLKINKDGIIGYGKEKMITENXHQRKHMKKYTENHLKNHTEKYMKKYTKNHLKNHTVKYRKKYKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.13
4 0.12
5 0.12
6 0.12
7 0.17
8 0.17
9 0.16
10 0.17
11 0.24
12 0.29
13 0.35
14 0.44
15 0.44
16 0.49
17 0.56
18 0.58
19 0.54
20 0.52
21 0.47
22 0.39
23 0.33
24 0.27
25 0.19
26 0.14
27 0.12
28 0.1
29 0.09
30 0.09
31 0.1
32 0.13
33 0.16
34 0.17
35 0.24
36 0.29
37 0.37
38 0.44
39 0.51
40 0.52
41 0.54
42 0.55
43 0.5
44 0.47
45 0.42
46 0.39
47 0.31
48 0.28
49 0.23
50 0.21
51 0.18
52 0.15
53 0.13
54 0.08
55 0.07
56 0.06
57 0.06
58 0.06
59 0.07
60 0.08
61 0.09
62 0.12
63 0.15
64 0.15
65 0.2
66 0.23
67 0.25
68 0.26
69 0.28
70 0.26
71 0.24
72 0.25
73 0.2
74 0.2
75 0.18
76 0.16
77 0.17
78 0.15
79 0.14
80 0.14
81 0.15
82 0.15
83 0.21
84 0.3
85 0.35
86 0.38
87 0.47
88 0.52
89 0.54
90 0.61
91 0.62
92 0.61
93 0.6
94 0.65
95 0.67
96 0.73
97 0.75
98 0.7
99 0.72
100 0.7
101 0.65
102 0.63
103 0.59
104 0.56
105 0.56
106 0.58
107 0.6
108 0.6
109 0.64
110 0.68
111 0.72
112 0.75
113 0.79
114 0.81
115 0.8
116 0.84
117 0.85
118 0.86
119 0.86
120 0.85
121 0.84
122 0.85
123 0.87