Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7WB26

Protein Details
Accession S7WB26    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
82-107NYNGKLKTDKNRIKHKKSKINEYNEEHydrophilic
NLS Segment(s)
PositionSequence
94-98IKHKK
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSYKYTHYLNDFEFKRDYKLSEEIILEYKRIKSNIKNIEYMIINYDNSKKRYKNAYKIIESLYNCVDKIDKYMTTLIDELFNYNGKLKTDKNRIKHKKSKINEYNEESNKSNINVFENLHRKKHLFIILNKLFKLIYILDNFKTINIKILTNFSVYKNKLIDKIIIKKYNINKISKKDGSQYCSEINKIYRDYFNSNDYLYSYIHKLTIFASTALPMAYLFISYFYIDNIIDNSSYCSYNSIKERNRIYIDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.38
4 0.36
5 0.32
6 0.36
7 0.34
8 0.34
9 0.33
10 0.3
11 0.34
12 0.32
13 0.28
14 0.26
15 0.28
16 0.28
17 0.3
18 0.34
19 0.35
20 0.44
21 0.53
22 0.55
23 0.53
24 0.49
25 0.51
26 0.46
27 0.4
28 0.34
29 0.25
30 0.21
31 0.21
32 0.28
33 0.3
34 0.32
35 0.39
36 0.37
37 0.42
38 0.53
39 0.61
40 0.63
41 0.67
42 0.73
43 0.69
44 0.7
45 0.67
46 0.62
47 0.53
48 0.45
49 0.38
50 0.3
51 0.26
52 0.23
53 0.21
54 0.14
55 0.17
56 0.18
57 0.15
58 0.16
59 0.19
60 0.19
61 0.19
62 0.2
63 0.16
64 0.14
65 0.14
66 0.13
67 0.12
68 0.12
69 0.1
70 0.13
71 0.14
72 0.13
73 0.16
74 0.2
75 0.28
76 0.38
77 0.45
78 0.5
79 0.6
80 0.69
81 0.77
82 0.82
83 0.83
84 0.82
85 0.81
86 0.84
87 0.81
88 0.8
89 0.77
90 0.73
91 0.72
92 0.65
93 0.63
94 0.53
95 0.45
96 0.37
97 0.3
98 0.26
99 0.17
100 0.17
101 0.15
102 0.14
103 0.2
104 0.28
105 0.3
106 0.3
107 0.31
108 0.29
109 0.29
110 0.33
111 0.32
112 0.29
113 0.29
114 0.38
115 0.42
116 0.43
117 0.42
118 0.37
119 0.3
120 0.25
121 0.24
122 0.15
123 0.12
124 0.12
125 0.14
126 0.14
127 0.16
128 0.16
129 0.15
130 0.15
131 0.12
132 0.15
133 0.14
134 0.15
135 0.14
136 0.17
137 0.18
138 0.18
139 0.19
140 0.17
141 0.23
142 0.23
143 0.26
144 0.26
145 0.26
146 0.28
147 0.28
148 0.3
149 0.29
150 0.38
151 0.42
152 0.45
153 0.44
154 0.48
155 0.53
156 0.57
157 0.56
158 0.54
159 0.53
160 0.53
161 0.62
162 0.59
163 0.55
164 0.54
165 0.54
166 0.51
167 0.48
168 0.46
169 0.41
170 0.4
171 0.39
172 0.34
173 0.31
174 0.31
175 0.3
176 0.29
177 0.27
178 0.3
179 0.34
180 0.33
181 0.33
182 0.31
183 0.28
184 0.26
185 0.24
186 0.21
187 0.17
188 0.16
189 0.15
190 0.14
191 0.15
192 0.15
193 0.14
194 0.13
195 0.16
196 0.15
197 0.14
198 0.14
199 0.13
200 0.14
201 0.13
202 0.12
203 0.08
204 0.08
205 0.07
206 0.07
207 0.06
208 0.07
209 0.08
210 0.09
211 0.09
212 0.08
213 0.1
214 0.09
215 0.1
216 0.1
217 0.11
218 0.1
219 0.1
220 0.14
221 0.15
222 0.16
223 0.15
224 0.18
225 0.18
226 0.25
227 0.32
228 0.38
229 0.43
230 0.51
231 0.56
232 0.61