Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7W674

Protein Details
Accession S7W674    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-92RIEEINKKYKNKRKRVSWKSEIKSIKHydrophilic
NLS Segment(s)
PositionSequence
73-83KKYKNKRKRVS
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MKIIDDIKYILSIEDENELYTRSLQILQYISESIYSSIKEDFIFKEFINIVTNNFKKNPQIKEQLDRIEEINKKYKNKRKRVSWKSEIKSIKHYQIEQQEEIKSKLNSPIKKYNAVPKEYGKEAQIQEEREKQTVKVTNIINKQIFIPMELAEEPSKYNNVNYFSVDTVSLPCIDLSKENTTYAYDDNFNTDVNLLSKIKVKELKAKIKEMKMTRKIEEWT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.13
5 0.14
6 0.13
7 0.13
8 0.13
9 0.11
10 0.14
11 0.13
12 0.17
13 0.17
14 0.17
15 0.17
16 0.17
17 0.16
18 0.14
19 0.14
20 0.12
21 0.12
22 0.12
23 0.11
24 0.12
25 0.12
26 0.12
27 0.14
28 0.14
29 0.15
30 0.17
31 0.16
32 0.19
33 0.19
34 0.19
35 0.21
36 0.19
37 0.19
38 0.26
39 0.28
40 0.27
41 0.28
42 0.29
43 0.34
44 0.41
45 0.44
46 0.43
47 0.51
48 0.52
49 0.58
50 0.61
51 0.59
52 0.53
53 0.48
54 0.41
55 0.39
56 0.38
57 0.35
58 0.38
59 0.37
60 0.43
61 0.51
62 0.6
63 0.63
64 0.7
65 0.75
66 0.78
67 0.85
68 0.88
69 0.88
70 0.89
71 0.89
72 0.81
73 0.81
74 0.75
75 0.66
76 0.64
77 0.58
78 0.55
79 0.47
80 0.44
81 0.41
82 0.43
83 0.45
84 0.39
85 0.37
86 0.33
87 0.32
88 0.32
89 0.31
90 0.23
91 0.2
92 0.26
93 0.29
94 0.3
95 0.34
96 0.42
97 0.41
98 0.45
99 0.45
100 0.46
101 0.46
102 0.45
103 0.41
104 0.36
105 0.36
106 0.34
107 0.34
108 0.26
109 0.26
110 0.23
111 0.27
112 0.27
113 0.26
114 0.28
115 0.33
116 0.34
117 0.3
118 0.31
119 0.25
120 0.29
121 0.32
122 0.3
123 0.3
124 0.3
125 0.35
126 0.38
127 0.44
128 0.37
129 0.32
130 0.31
131 0.27
132 0.25
133 0.19
134 0.16
135 0.11
136 0.12
137 0.12
138 0.13
139 0.11
140 0.11
141 0.11
142 0.11
143 0.12
144 0.11
145 0.13
146 0.15
147 0.19
148 0.2
149 0.21
150 0.22
151 0.21
152 0.22
153 0.2
154 0.16
155 0.13
156 0.13
157 0.11
158 0.1
159 0.09
160 0.09
161 0.1
162 0.12
163 0.15
164 0.2
165 0.21
166 0.21
167 0.22
168 0.23
169 0.24
170 0.23
171 0.21
172 0.18
173 0.16
174 0.2
175 0.2
176 0.18
177 0.17
178 0.15
179 0.14
180 0.13
181 0.17
182 0.14
183 0.15
184 0.21
185 0.22
186 0.29
187 0.33
188 0.36
189 0.42
190 0.51
191 0.6
192 0.6
193 0.69
194 0.7
195 0.71
196 0.76
197 0.75
198 0.77
199 0.75
200 0.76
201 0.69