Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7XID0

Protein Details
Accession S7XID0    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
22-46HYLKNSNFSKRIKKKKSEDGERLLDHydrophilic
89-114LFDNKTRKQIKAKYKREEKNNPQKISHydrophilic
NLS Segment(s)
PositionSequence
32-37RIKKKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
IPR039467  TFIIIB_B''_Myb  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF15963  Myb_DNA-bind_7  
CDD cd00167  SANT  
Amino Acid Sequences MTIKIKYKNLLLSTPMDLNLSHYLKNSNFSKRIKKKKSEDGERLLDEEIITSHTFRKRAKFPRWTITENELFFNALEICGLEFTLISELFDNKTRKQIKAKYKREEKNNPQKISSIMSKIKSFDAEKYNSLKVKYKKTDNSLNNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.25
4 0.21
5 0.22
6 0.26
7 0.24
8 0.22
9 0.21
10 0.25
11 0.25
12 0.32
13 0.33
14 0.34
15 0.4
16 0.45
17 0.56
18 0.61
19 0.72
20 0.75
21 0.8
22 0.81
23 0.84
24 0.88
25 0.87
26 0.85
27 0.81
28 0.77
29 0.68
30 0.61
31 0.5
32 0.4
33 0.29
34 0.21
35 0.13
36 0.1
37 0.09
38 0.08
39 0.12
40 0.15
41 0.19
42 0.21
43 0.27
44 0.35
45 0.44
46 0.53
47 0.58
48 0.61
49 0.66
50 0.69
51 0.66
52 0.6
53 0.56
54 0.51
55 0.42
56 0.37
57 0.28
58 0.23
59 0.19
60 0.16
61 0.11
62 0.06
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.03
69 0.03
70 0.03
71 0.05
72 0.04
73 0.05
74 0.05
75 0.06
76 0.08
77 0.14
78 0.17
79 0.16
80 0.26
81 0.29
82 0.33
83 0.41
84 0.49
85 0.54
86 0.63
87 0.72
88 0.73
89 0.8
90 0.84
91 0.85
92 0.87
93 0.87
94 0.87
95 0.87
96 0.8
97 0.71
98 0.65
99 0.57
100 0.51
101 0.44
102 0.4
103 0.36
104 0.36
105 0.37
106 0.37
107 0.36
108 0.36
109 0.33
110 0.32
111 0.34
112 0.34
113 0.36
114 0.39
115 0.44
116 0.43
117 0.44
118 0.47
119 0.47
120 0.55
121 0.59
122 0.65
123 0.68
124 0.72
125 0.79