Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7XKI2

Protein Details
Accession S7XKI2    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
317-338AYGDKCNSKKWIKKFIKYGLSGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, nucl 11.5, cyto 9.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR030395  GP_PDE_dom  
IPR017946  PLC-like_Pdiesterase_TIM-brl  
Gene Ontology GO:0008081  F:phosphoric diester hydrolase activity  
GO:0006629  P:lipid metabolic process  
Pfam View protein in Pfam  
PF03009  GDPD  
PROSITE View protein in PROSITE  
PS51704  GP_PDE  
Amino Acid Sequences MVFDLYLRLINMEQEFSFKILIKTNNKKYTMDIHKDIFFITAIDRNTELRFILTVENISYESKKYIAKELYEKGNIEVTFTDRNTQKNINKVLFVSKTLQNKDFYKEYFKHPIIIGHRGSGADNYNKKNNIFADITENTIDSFNNAHKLNVDWIEFDVQLTKDKILVIYHDFNFNGIPVNELNFFEIKEKMKNICTLEDVFKKVPADIGFNIEIKYDSKHKTNISPTEFLSYIIEICQSYNRKIFFTSFDPDILVLLRNSGYPLFLLFESLNYKDIIQINLQSAYNFVKNMGFHGLILDSNLITTEIEKMNDIIIFAYGDKCNSKKWIKKFIKYGLSGIITDDIKNINSSVFETN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.19
4 0.21
5 0.19
6 0.2
7 0.23
8 0.32
9 0.39
10 0.49
11 0.58
12 0.65
13 0.66
14 0.65
15 0.62
16 0.64
17 0.64
18 0.62
19 0.57
20 0.52
21 0.51
22 0.5
23 0.47
24 0.37
25 0.27
26 0.19
27 0.16
28 0.17
29 0.15
30 0.17
31 0.18
32 0.19
33 0.19
34 0.2
35 0.18
36 0.14
37 0.14
38 0.13
39 0.14
40 0.13
41 0.13
42 0.12
43 0.13
44 0.14
45 0.15
46 0.15
47 0.14
48 0.14
49 0.16
50 0.18
51 0.19
52 0.26
53 0.28
54 0.31
55 0.37
56 0.41
57 0.45
58 0.46
59 0.45
60 0.38
61 0.4
62 0.35
63 0.29
64 0.25
65 0.21
66 0.23
67 0.22
68 0.27
69 0.24
70 0.26
71 0.3
72 0.37
73 0.38
74 0.41
75 0.48
76 0.44
77 0.43
78 0.42
79 0.44
80 0.37
81 0.36
82 0.32
83 0.3
84 0.36
85 0.38
86 0.4
87 0.38
88 0.39
89 0.41
90 0.41
91 0.37
92 0.38
93 0.36
94 0.39
95 0.44
96 0.43
97 0.41
98 0.38
99 0.42
100 0.38
101 0.42
102 0.36
103 0.28
104 0.28
105 0.25
106 0.25
107 0.2
108 0.2
109 0.2
110 0.25
111 0.28
112 0.32
113 0.34
114 0.34
115 0.36
116 0.33
117 0.3
118 0.26
119 0.23
120 0.24
121 0.22
122 0.24
123 0.2
124 0.2
125 0.15
126 0.15
127 0.14
128 0.08
129 0.08
130 0.08
131 0.12
132 0.13
133 0.12
134 0.12
135 0.13
136 0.16
137 0.17
138 0.16
139 0.12
140 0.13
141 0.14
142 0.13
143 0.12
144 0.11
145 0.09
146 0.11
147 0.12
148 0.11
149 0.1
150 0.1
151 0.11
152 0.09
153 0.11
154 0.12
155 0.15
156 0.16
157 0.17
158 0.16
159 0.16
160 0.16
161 0.14
162 0.12
163 0.08
164 0.08
165 0.07
166 0.08
167 0.09
168 0.09
169 0.1
170 0.08
171 0.09
172 0.09
173 0.12
174 0.12
175 0.13
176 0.15
177 0.17
178 0.18
179 0.22
180 0.23
181 0.21
182 0.22
183 0.22
184 0.24
185 0.25
186 0.26
187 0.22
188 0.23
189 0.22
190 0.19
191 0.2
192 0.16
193 0.17
194 0.14
195 0.17
196 0.17
197 0.17
198 0.17
199 0.14
200 0.14
201 0.12
202 0.13
203 0.15
204 0.17
205 0.2
206 0.24
207 0.26
208 0.32
209 0.39
210 0.44
211 0.44
212 0.43
213 0.41
214 0.4
215 0.38
216 0.32
217 0.26
218 0.18
219 0.13
220 0.11
221 0.11
222 0.07
223 0.08
224 0.13
225 0.15
226 0.17
227 0.22
228 0.23
229 0.23
230 0.24
231 0.26
232 0.24
233 0.26
234 0.27
235 0.24
236 0.23
237 0.22
238 0.21
239 0.19
240 0.16
241 0.13
242 0.08
243 0.08
244 0.08
245 0.07
246 0.09
247 0.08
248 0.08
249 0.07
250 0.07
251 0.08
252 0.08
253 0.1
254 0.09
255 0.1
256 0.13
257 0.14
258 0.15
259 0.13
260 0.14
261 0.16
262 0.18
263 0.18
264 0.17
265 0.18
266 0.19
267 0.21
268 0.21
269 0.17
270 0.17
271 0.18
272 0.18
273 0.16
274 0.14
275 0.15
276 0.15
277 0.17
278 0.2
279 0.17
280 0.15
281 0.16
282 0.16
283 0.13
284 0.14
285 0.12
286 0.07
287 0.07
288 0.08
289 0.07
290 0.06
291 0.07
292 0.1
293 0.11
294 0.12
295 0.13
296 0.13
297 0.14
298 0.14
299 0.14
300 0.1
301 0.09
302 0.09
303 0.09
304 0.12
305 0.11
306 0.14
307 0.18
308 0.19
309 0.22
310 0.3
311 0.39
312 0.45
313 0.53
314 0.62
315 0.68
316 0.76
317 0.82
318 0.83
319 0.82
320 0.77
321 0.7
322 0.66
323 0.58
324 0.49
325 0.41
326 0.36
327 0.28
328 0.25
329 0.24
330 0.19
331 0.17
332 0.18
333 0.17
334 0.13
335 0.13