Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7WBK3

Protein Details
Accession S7WBK3    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
106-135FMGTKNKKVEDQKKKKSKNKKETTESKIRIHydrophilic
NLS Segment(s)
PositionSequence
112-126KKVEDQKKKKSKNKK
Subcellular Location(s) nucl 16.5, cyto_nucl 12.333, cyto 7, cyto_mito 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009582  Spc2/SPCS2  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06703  SPC25  
Amino Acid Sequences MERLEKKYKNTCIDTSDLDLVKATLNDYLSDYLTFVKQYKKSNLIVDIRNDVGILSTIITLVVLYYSLKVEFEKAKKIIAWLCAIYYIMNNLLELIVWLRYSNMIFMGTKNKKVEDQKKKKSKNKKETTESKIRIICSDQENNYEIIIYKNDNIIPIKYHRYLGDLFDEKGYFLYEEFTNDCDNVFLGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.49
3 0.46
4 0.38
5 0.32
6 0.28
7 0.24
8 0.21
9 0.18
10 0.14
11 0.1
12 0.11
13 0.11
14 0.13
15 0.14
16 0.14
17 0.14
18 0.14
19 0.13
20 0.13
21 0.14
22 0.14
23 0.2
24 0.24
25 0.31
26 0.37
27 0.42
28 0.45
29 0.47
30 0.53
31 0.51
32 0.5
33 0.46
34 0.43
35 0.37
36 0.34
37 0.29
38 0.21
39 0.15
40 0.12
41 0.09
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.04
53 0.04
54 0.05
55 0.05
56 0.06
57 0.08
58 0.14
59 0.16
60 0.22
61 0.22
62 0.23
63 0.23
64 0.25
65 0.25
66 0.22
67 0.21
68 0.16
69 0.15
70 0.14
71 0.14
72 0.11
73 0.09
74 0.07
75 0.06
76 0.06
77 0.05
78 0.05
79 0.05
80 0.04
81 0.04
82 0.04
83 0.04
84 0.03
85 0.04
86 0.04
87 0.05
88 0.05
89 0.05
90 0.05
91 0.06
92 0.06
93 0.07
94 0.18
95 0.19
96 0.23
97 0.24
98 0.25
99 0.29
100 0.38
101 0.48
102 0.5
103 0.59
104 0.65
105 0.75
106 0.84
107 0.88
108 0.9
109 0.91
110 0.9
111 0.9
112 0.89
113 0.89
114 0.88
115 0.87
116 0.87
117 0.78
118 0.74
119 0.66
120 0.57
121 0.49
122 0.42
123 0.38
124 0.33
125 0.36
126 0.31
127 0.31
128 0.32
129 0.3
130 0.27
131 0.23
132 0.18
133 0.13
134 0.13
135 0.12
136 0.12
137 0.14
138 0.14
139 0.17
140 0.18
141 0.18
142 0.2
143 0.23
144 0.29
145 0.28
146 0.3
147 0.28
148 0.3
149 0.3
150 0.29
151 0.33
152 0.29
153 0.28
154 0.28
155 0.28
156 0.24
157 0.23
158 0.22
159 0.14
160 0.11
161 0.13
162 0.11
163 0.14
164 0.15
165 0.16
166 0.17
167 0.16
168 0.16
169 0.14