Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7WAH9

Protein Details
Accession S7WAH9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MTKCKKRRYRGRRRVCYECKSKKPTLKTSPBasic
NLS Segment(s)
PositionSequence
6-13KRRYRGRR
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MTKCKKRRYRGRRRVCYECKSKKPTLKTSPEINLIKIRKQNFTDAKIIQRIGKYKKFEELNLIEKKVMMITSRKYKKLLKIYILNQETLNNSKRLGRERHNEKMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.91
3 0.89
4 0.89
5 0.88
6 0.87
7 0.83
8 0.84
9 0.81
10 0.8
11 0.81
12 0.8
13 0.78
14 0.73
15 0.72
16 0.68
17 0.69
18 0.61
19 0.53
20 0.51
21 0.44
22 0.44
23 0.42
24 0.4
25 0.37
26 0.37
27 0.44
28 0.41
29 0.43
30 0.43
31 0.4
32 0.41
33 0.38
34 0.37
35 0.31
36 0.28
37 0.3
38 0.31
39 0.35
40 0.34
41 0.33
42 0.38
43 0.37
44 0.35
45 0.36
46 0.34
47 0.36
48 0.36
49 0.36
50 0.29
51 0.28
52 0.27
53 0.2
54 0.17
55 0.11
56 0.12
57 0.16
58 0.27
59 0.33
60 0.35
61 0.39
62 0.44
63 0.51
64 0.58
65 0.6
66 0.57
67 0.6
68 0.62
69 0.68
70 0.64
71 0.56
72 0.47
73 0.42
74 0.37
75 0.35
76 0.33
77 0.24
78 0.23
79 0.27
80 0.31
81 0.37
82 0.42
83 0.46
84 0.53
85 0.61