Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7XQT9

Protein Details
Accession S7XQT9   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
31-60NYVTVTKLKKYNKNKDKKNKENNNKESNNDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 9, cyto_nucl 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MKIILPTIKGVIPHTLKQLPIKVYIDDIIINYVTVTKLKKYNKNKDKKNKENNNKESNNDENDTDNINKNNKENKDNNTNNTNNHTKDNNTNNINNHTKSNDDTKDNNINNHIKDNDTNNINNDISIFYYKGNEYQMKIELNYTLSNFLNNNNDIIMVFKDKQLYSKNSNNYTIENINDNNNTKNINDNNEQLSSYEMNNKKRKLSSNNIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.36
4 0.4
5 0.45
6 0.39
7 0.4
8 0.4
9 0.34
10 0.33
11 0.31
12 0.26
13 0.21
14 0.19
15 0.15
16 0.12
17 0.11
18 0.09
19 0.09
20 0.09
21 0.11
22 0.12
23 0.14
24 0.22
25 0.31
26 0.41
27 0.51
28 0.62
29 0.7
30 0.79
31 0.86
32 0.89
33 0.92
34 0.93
35 0.94
36 0.94
37 0.94
38 0.95
39 0.93
40 0.92
41 0.84
42 0.76
43 0.7
44 0.64
45 0.58
46 0.48
47 0.4
48 0.31
49 0.29
50 0.29
51 0.26
52 0.24
53 0.23
54 0.25
55 0.26
56 0.29
57 0.36
58 0.37
59 0.42
60 0.44
61 0.47
62 0.53
63 0.56
64 0.55
65 0.56
66 0.54
67 0.48
68 0.49
69 0.48
70 0.39
71 0.38
72 0.35
73 0.3
74 0.35
75 0.39
76 0.4
77 0.38
78 0.39
79 0.38
80 0.43
81 0.44
82 0.38
83 0.33
84 0.27
85 0.25
86 0.24
87 0.28
88 0.24
89 0.24
90 0.24
91 0.28
92 0.36
93 0.35
94 0.35
95 0.33
96 0.34
97 0.31
98 0.33
99 0.28
100 0.21
101 0.22
102 0.24
103 0.22
104 0.22
105 0.22
106 0.2
107 0.23
108 0.21
109 0.19
110 0.17
111 0.13
112 0.11
113 0.12
114 0.1
115 0.07
116 0.09
117 0.09
118 0.11
119 0.14
120 0.15
121 0.15
122 0.17
123 0.2
124 0.19
125 0.2
126 0.19
127 0.16
128 0.15
129 0.15
130 0.14
131 0.13
132 0.12
133 0.13
134 0.13
135 0.15
136 0.18
137 0.17
138 0.17
139 0.14
140 0.14
141 0.13
142 0.14
143 0.13
144 0.12
145 0.13
146 0.14
147 0.18
148 0.18
149 0.23
150 0.28
151 0.32
152 0.35
153 0.43
154 0.49
155 0.5
156 0.55
157 0.52
158 0.48
159 0.46
160 0.41
161 0.35
162 0.31
163 0.28
164 0.27
165 0.3
166 0.3
167 0.27
168 0.27
169 0.27
170 0.23
171 0.3
172 0.3
173 0.32
174 0.34
175 0.35
176 0.37
177 0.37
178 0.37
179 0.29
180 0.29
181 0.24
182 0.22
183 0.28
184 0.31
185 0.39
186 0.47
187 0.51
188 0.54
189 0.6
190 0.67
191 0.67