Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7XFN1

Protein Details
Accession S7XFN1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
41-74QKLKERFIRRSKEDKKVKKGKKRFYVKKKPIVKEBasic
NLS Segment(s)
PositionSequence
44-74KERFIRRSKEDKKVKKGKKRFYVKKKPIVKE
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MSNKEKKSKIEIIEDPRFHAKCNYTKHYKDYGFLYPKEVTQKLKERFIRRSKEDKKVKKGKKRFYVKKKPIVKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.57
3 0.57
4 0.52
5 0.45
6 0.42
7 0.39
8 0.37
9 0.45
10 0.48
11 0.49
12 0.52
13 0.56
14 0.59
15 0.54
16 0.49
17 0.44
18 0.45
19 0.41
20 0.39
21 0.37
22 0.29
23 0.29
24 0.32
25 0.3
26 0.24
27 0.26
28 0.35
29 0.35
30 0.43
31 0.48
32 0.5
33 0.58
34 0.64
35 0.67
36 0.64
37 0.72
38 0.72
39 0.75
40 0.8
41 0.8
42 0.82
43 0.84
44 0.88
45 0.88
46 0.9
47 0.9
48 0.9
49 0.92
50 0.92
51 0.92
52 0.94
53 0.93
54 0.93