Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7XL99

Protein Details
Accession S7XL99    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
114-138KSSGLIGKKIKKKPIKVLTEKREIRBasic
NLS Segment(s)
PositionSequence
120-138GKKIKKKPIKVLTEKREIR
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MGAQRKVYVAVTKELFEQIKRIRADETPTSLMRITNLSQNSIYKLLRLFDENPFATFGDYSCKKGRKLKNREAEVAVIRDIFADDNSLTQIGVREEYMARVGYVSQSTIHRLIKSSGLIGKKIKKKPIKVLTEKREIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.25
4 0.29
5 0.28
6 0.34
7 0.34
8 0.34
9 0.32
10 0.33
11 0.38
12 0.36
13 0.37
14 0.34
15 0.33
16 0.34
17 0.32
18 0.29
19 0.24
20 0.22
21 0.17
22 0.19
23 0.19
24 0.19
25 0.2
26 0.21
27 0.22
28 0.23
29 0.22
30 0.17
31 0.18
32 0.17
33 0.16
34 0.19
35 0.18
36 0.17
37 0.23
38 0.22
39 0.22
40 0.22
41 0.21
42 0.18
43 0.15
44 0.12
45 0.14
46 0.15
47 0.18
48 0.22
49 0.25
50 0.28
51 0.37
52 0.46
53 0.5
54 0.59
55 0.64
56 0.68
57 0.69
58 0.7
59 0.62
60 0.56
61 0.47
62 0.38
63 0.29
64 0.19
65 0.15
66 0.12
67 0.1
68 0.07
69 0.05
70 0.06
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.07
79 0.07
80 0.07
81 0.08
82 0.08
83 0.09
84 0.11
85 0.09
86 0.09
87 0.08
88 0.08
89 0.09
90 0.09
91 0.09
92 0.1
93 0.11
94 0.14
95 0.19
96 0.21
97 0.21
98 0.22
99 0.23
100 0.25
101 0.25
102 0.24
103 0.25
104 0.25
105 0.28
106 0.33
107 0.41
108 0.47
109 0.53
110 0.6
111 0.64
112 0.7
113 0.77
114 0.81
115 0.82
116 0.84
117 0.87
118 0.86