Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7W993

Protein Details
Accession S7W993    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
150-171DESVINKRKYNKGRIVKTKWILHydrophilic
NLS Segment(s)
PositionSequence
131-140KNRKKNFKKI
Subcellular Location(s) nucl 13.5, cyto_nucl 10, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MQYEDFLSIESDVDFYSKLFSTNCFLPVLQHMGILIKNKICDKCQKSMKININLEEEKSYFRCLSYKCNKNKVTIKKYSILEKKNIKFKTFIILIYGWVQNHALQQQINNTKLSKKTIIYWHKIFREMVAKNRKKNFKKIGGVEKTVKIDESVINKRKYNKGRIVKTKWILGGIFMEDGNLFFSNYLIEKWKLLKMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.1
4 0.1
5 0.11
6 0.11
7 0.13
8 0.17
9 0.19
10 0.21
11 0.2
12 0.19
13 0.2
14 0.22
15 0.25
16 0.21
17 0.18
18 0.17
19 0.17
20 0.19
21 0.2
22 0.19
23 0.16
24 0.19
25 0.24
26 0.27
27 0.29
28 0.37
29 0.39
30 0.46
31 0.53
32 0.59
33 0.6
34 0.67
35 0.72
36 0.72
37 0.7
38 0.65
39 0.62
40 0.54
41 0.5
42 0.42
43 0.34
44 0.27
45 0.24
46 0.23
47 0.17
48 0.16
49 0.2
50 0.19
51 0.28
52 0.36
53 0.44
54 0.49
55 0.59
56 0.6
57 0.64
58 0.71
59 0.72
60 0.71
61 0.7
62 0.66
63 0.63
64 0.63
65 0.64
66 0.63
67 0.55
68 0.54
69 0.55
70 0.56
71 0.57
72 0.58
73 0.5
74 0.44
75 0.41
76 0.4
77 0.32
78 0.27
79 0.21
80 0.19
81 0.18
82 0.19
83 0.19
84 0.12
85 0.11
86 0.11
87 0.09
88 0.1
89 0.1
90 0.09
91 0.08
92 0.09
93 0.15
94 0.19
95 0.2
96 0.21
97 0.21
98 0.23
99 0.25
100 0.28
101 0.24
102 0.21
103 0.25
104 0.33
105 0.4
106 0.43
107 0.47
108 0.5
109 0.49
110 0.5
111 0.45
112 0.38
113 0.39
114 0.34
115 0.38
116 0.43
117 0.47
118 0.52
119 0.6
120 0.68
121 0.66
122 0.74
123 0.74
124 0.73
125 0.76
126 0.76
127 0.78
128 0.74
129 0.73
130 0.67
131 0.61
132 0.54
133 0.45
134 0.38
135 0.28
136 0.23
137 0.22
138 0.25
139 0.31
140 0.36
141 0.4
142 0.43
143 0.49
144 0.57
145 0.61
146 0.64
147 0.64
148 0.67
149 0.73
150 0.81
151 0.83
152 0.83
153 0.79
154 0.74
155 0.66
156 0.58
157 0.48
158 0.39
159 0.32
160 0.24
161 0.2
162 0.15
163 0.14
164 0.11
165 0.11
166 0.12
167 0.1
168 0.09
169 0.08
170 0.08
171 0.09
172 0.1
173 0.12
174 0.15
175 0.15
176 0.18
177 0.22