Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7W8E8

Protein Details
Accession S7W8E8    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
97-138IVKKTETDDRRKMKKRKKDKIRAEKRKWKKINMKENTEKVNKBasic
NLS Segment(s)
PositionSequence
106-131RRKMKKRKKDKIRAEKRKWKKINMKE
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 3
Family & Domain DBs
Amino Acid Sequences MEIINKIFEMNCIMDNNFNLILKLLRPKNNNYIEDISLILTLPRKISDDKYKILIEKYLSMDYLYLVEVYKFLREYGDDILLEKYMSKFNNTDENEIVKKTETDDRRKMKKRKKDKIRAEKRKWKKINMKENTEKVNKIREEKIEYENKMRKIYRELNWKYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.22
4 0.2
5 0.18
6 0.16
7 0.15
8 0.15
9 0.15
10 0.24
11 0.27
12 0.33
13 0.37
14 0.43
15 0.51
16 0.59
17 0.57
18 0.54
19 0.51
20 0.45
21 0.42
22 0.36
23 0.27
24 0.19
25 0.17
26 0.12
27 0.1
28 0.1
29 0.1
30 0.1
31 0.12
32 0.14
33 0.21
34 0.3
35 0.33
36 0.34
37 0.38
38 0.39
39 0.38
40 0.37
41 0.34
42 0.25
43 0.24
44 0.24
45 0.2
46 0.19
47 0.17
48 0.16
49 0.13
50 0.12
51 0.08
52 0.06
53 0.05
54 0.05
55 0.06
56 0.06
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.08
63 0.09
64 0.11
65 0.1
66 0.1
67 0.11
68 0.1
69 0.1
70 0.08
71 0.07
72 0.09
73 0.1
74 0.11
75 0.11
76 0.13
77 0.22
78 0.23
79 0.25
80 0.23
81 0.26
82 0.26
83 0.25
84 0.24
85 0.15
86 0.14
87 0.14
88 0.2
89 0.23
90 0.31
91 0.4
92 0.48
93 0.58
94 0.68
95 0.76
96 0.78
97 0.83
98 0.86
99 0.87
100 0.9
101 0.91
102 0.92
103 0.93
104 0.95
105 0.96
106 0.95
107 0.95
108 0.94
109 0.94
110 0.9
111 0.9
112 0.89
113 0.88
114 0.88
115 0.86
116 0.86
117 0.84
118 0.83
119 0.81
120 0.75
121 0.69
122 0.62
123 0.61
124 0.56
125 0.52
126 0.52
127 0.5
128 0.52
129 0.52
130 0.56
131 0.56
132 0.55
133 0.6
134 0.61
135 0.59
136 0.6
137 0.58
138 0.54
139 0.55
140 0.6
141 0.58
142 0.62