Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7W6D3

Protein Details
Accession S7W6D3   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
76-101EQIKNYRKYVKKKTESKKITRNNFNEHydrophilic
118-140IKPNKNKIISKTQRKGKYRFLTHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences PATSIIKKYNIENIYAEKVLERKYHKPLYDNIFRNKKFSVSGKTTKEKNYIIIEHGNLNTAKPLDKISAKKIHLEEQIKNYRKYVKKKTESKKITRNNFNEYHYNKLAIERKLECEIIKPNKNKIISKTQRKGKYRFLTHPINNFEVIEINLEDEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.31
4 0.24
5 0.26
6 0.27
7 0.31
8 0.32
9 0.33
10 0.42
11 0.5
12 0.5
13 0.51
14 0.55
15 0.56
16 0.61
17 0.61
18 0.61
19 0.64
20 0.62
21 0.61
22 0.55
23 0.49
24 0.43
25 0.43
26 0.41
27 0.39
28 0.47
29 0.5
30 0.56
31 0.58
32 0.58
33 0.58
34 0.51
35 0.48
36 0.44
37 0.39
38 0.35
39 0.34
40 0.3
41 0.26
42 0.25
43 0.23
44 0.18
45 0.16
46 0.14
47 0.12
48 0.12
49 0.1
50 0.11
51 0.11
52 0.16
53 0.19
54 0.24
55 0.32
56 0.32
57 0.36
58 0.36
59 0.39
60 0.41
61 0.42
62 0.38
63 0.38
64 0.47
65 0.46
66 0.45
67 0.42
68 0.43
69 0.47
70 0.53
71 0.55
72 0.56
73 0.62
74 0.72
75 0.79
76 0.82
77 0.84
78 0.84
79 0.83
80 0.82
81 0.82
82 0.81
83 0.77
84 0.73
85 0.68
86 0.63
87 0.61
88 0.55
89 0.52
90 0.43
91 0.4
92 0.33
93 0.36
94 0.38
95 0.32
96 0.34
97 0.29
98 0.32
99 0.33
100 0.34
101 0.28
102 0.25
103 0.33
104 0.36
105 0.43
106 0.43
107 0.47
108 0.53
109 0.58
110 0.58
111 0.55
112 0.58
113 0.6
114 0.67
115 0.7
116 0.73
117 0.77
118 0.81
119 0.81
120 0.81
121 0.8
122 0.78
123 0.77
124 0.75
125 0.75
126 0.74
127 0.76
128 0.71
129 0.63
130 0.56
131 0.47
132 0.41
133 0.32
134 0.26
135 0.2
136 0.15