Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7WEE5

Protein Details
Accession S7WEE5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
175-202DTSNTDKNSKKKTAKEKVSQENKQHEEKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR008978  HSP20-like_chaperone  
Amino Acid Sequences MISFSFSFKLYNICIFISAIMYKSHYNLHYMSNICIMLLLNYINATITNPQMFDVIEKEENDRTLITIPVPTNIKPESIKIKYDKNSYTICYNQSNKHNEEGLATYSEVQGCVVKELPYEIRNPKAKIKNGELMLSFQRGENLDYKPKELSIEYEGENKTKDEEASSEKRNVLKDTSNTDKNSKKKTAKEKVSQENKQHEEKVSQENKQHEEKVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.19
4 0.17
5 0.15
6 0.13
7 0.12
8 0.14
9 0.14
10 0.15
11 0.2
12 0.18
13 0.21
14 0.21
15 0.23
16 0.27
17 0.27
18 0.27
19 0.25
20 0.24
21 0.2
22 0.19
23 0.16
24 0.11
25 0.11
26 0.09
27 0.06
28 0.07
29 0.07
30 0.06
31 0.06
32 0.07
33 0.08
34 0.1
35 0.1
36 0.1
37 0.11
38 0.12
39 0.11
40 0.11
41 0.11
42 0.13
43 0.14
44 0.15
45 0.17
46 0.18
47 0.19
48 0.18
49 0.17
50 0.14
51 0.13
52 0.13
53 0.1
54 0.13
55 0.12
56 0.15
57 0.17
58 0.16
59 0.19
60 0.19
61 0.2
62 0.17
63 0.2
64 0.26
65 0.26
66 0.3
67 0.3
68 0.37
69 0.39
70 0.45
71 0.43
72 0.38
73 0.38
74 0.35
75 0.36
76 0.31
77 0.3
78 0.3
79 0.32
80 0.33
81 0.39
82 0.42
83 0.4
84 0.39
85 0.37
86 0.31
87 0.29
88 0.25
89 0.18
90 0.14
91 0.12
92 0.1
93 0.1
94 0.09
95 0.08
96 0.07
97 0.07
98 0.06
99 0.07
100 0.07
101 0.07
102 0.07
103 0.08
104 0.11
105 0.11
106 0.15
107 0.16
108 0.22
109 0.27
110 0.3
111 0.37
112 0.42
113 0.46
114 0.48
115 0.5
116 0.5
117 0.46
118 0.46
119 0.38
120 0.33
121 0.3
122 0.26
123 0.21
124 0.14
125 0.15
126 0.13
127 0.15
128 0.15
129 0.17
130 0.24
131 0.24
132 0.26
133 0.25
134 0.24
135 0.24
136 0.21
137 0.21
138 0.17
139 0.18
140 0.18
141 0.23
142 0.24
143 0.23
144 0.24
145 0.21
146 0.19
147 0.18
148 0.17
149 0.13
150 0.15
151 0.21
152 0.26
153 0.3
154 0.32
155 0.33
156 0.36
157 0.38
158 0.37
159 0.34
160 0.35
161 0.35
162 0.39
163 0.44
164 0.47
165 0.48
166 0.53
167 0.56
168 0.58
169 0.62
170 0.65
171 0.65
172 0.68
173 0.76
174 0.8
175 0.82
176 0.84
177 0.85
178 0.86
179 0.89
180 0.88
181 0.86
182 0.85
183 0.8
184 0.77
185 0.71
186 0.63
187 0.57
188 0.54
189 0.55
190 0.52
191 0.53
192 0.53
193 0.56
194 0.58
195 0.6