Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7W9A9

Protein Details
Accession S7W9A9    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
91-129LPKAFKTKVKEKTRWQKFAERKNIKKKKKIYDQNVDEYLHydrophilic
145-167KVEISIKSRNNKKIVKKMLTKQLHydrophilic
NLS Segment(s)
PositionSequence
93-119KAFKTKVKEKTRWQKFAERKNIKKKKK
Subcellular Location(s) mito 6, nucl 5, plas 4, pero 4, cyto_mito 4, E.R. 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0016020  C:membrane  
GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences YLFIKQIKVFLYDNKKNKFIKYEFSIKYNFFIFLILMFVDPHFLFISHPSSKSITEIISSINELKMNIMKNEYVRKEDIKIYKLPPPTIILPKAFKTKVKEKTRWQKFAERKNIKKKKKIYDQNVDEYLHNCKKGWNKYKSGIEKVEISIKSRNNKKIVKKMLTKQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.61
4 0.64
5 0.64
6 0.57
7 0.57
8 0.55
9 0.59
10 0.54
11 0.55
12 0.55
13 0.46
14 0.45
15 0.38
16 0.31
17 0.21
18 0.19
19 0.15
20 0.11
21 0.11
22 0.08
23 0.07
24 0.07
25 0.06
26 0.08
27 0.08
28 0.09
29 0.09
30 0.09
31 0.09
32 0.11
33 0.17
34 0.17
35 0.18
36 0.18
37 0.2
38 0.2
39 0.21
40 0.2
41 0.14
42 0.13
43 0.13
44 0.12
45 0.11
46 0.11
47 0.1
48 0.1
49 0.1
50 0.09
51 0.1
52 0.12
53 0.12
54 0.12
55 0.13
56 0.13
57 0.15
58 0.22
59 0.23
60 0.23
61 0.23
62 0.24
63 0.25
64 0.3
65 0.31
66 0.27
67 0.29
68 0.28
69 0.32
70 0.32
71 0.3
72 0.26
73 0.24
74 0.25
75 0.25
76 0.25
77 0.23
78 0.23
79 0.25
80 0.3
81 0.28
82 0.29
83 0.31
84 0.38
85 0.46
86 0.52
87 0.58
88 0.62
89 0.72
90 0.78
91 0.8
92 0.75
93 0.75
94 0.75
95 0.77
96 0.78
97 0.77
98 0.77
99 0.81
100 0.87
101 0.86
102 0.87
103 0.86
104 0.85
105 0.86
106 0.87
107 0.86
108 0.86
109 0.84
110 0.81
111 0.76
112 0.67
113 0.57
114 0.48
115 0.46
116 0.39
117 0.33
118 0.26
119 0.28
120 0.35
121 0.44
122 0.53
123 0.53
124 0.56
125 0.64
126 0.74
127 0.77
128 0.75
129 0.69
130 0.61
131 0.56
132 0.52
133 0.51
134 0.42
135 0.37
136 0.37
137 0.39
138 0.46
139 0.51
140 0.57
141 0.58
142 0.66
143 0.72
144 0.76
145 0.81
146 0.81
147 0.82