Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7XHK8

Protein Details
Accession S7XHK8    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
96-115NMTEEEKKKVEKRKQKYSVDHydrophilic
NLS Segment(s)
PositionSequence
82-110KVNEKVEERRKRFGNMTEEEKKKVEKRKQ
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR036361  SAP_dom_sf  
Amino Acid Sequences MKYEEQTVAVLREECKKYNINTTNKKKSELIKTLQERTSSNINIDDKTNIDDNTNIDDKIERRRQRFGVMEDKIKEREEKYKVNEKVEERRKRFGNMTEEEKKKVEKRKQKYSVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.34
4 0.34
5 0.43
6 0.5
7 0.52
8 0.59
9 0.68
10 0.74
11 0.72
12 0.73
13 0.67
14 0.65
15 0.65
16 0.62
17 0.57
18 0.56
19 0.6
20 0.62
21 0.6
22 0.55
23 0.45
24 0.41
25 0.42
26 0.33
27 0.28
28 0.27
29 0.26
30 0.24
31 0.25
32 0.22
33 0.16
34 0.17
35 0.18
36 0.13
37 0.12
38 0.12
39 0.12
40 0.15
41 0.15
42 0.13
43 0.11
44 0.13
45 0.13
46 0.21
47 0.29
48 0.31
49 0.33
50 0.39
51 0.4
52 0.45
53 0.48
54 0.44
55 0.45
56 0.43
57 0.45
58 0.42
59 0.43
60 0.39
61 0.35
62 0.33
63 0.26
64 0.32
65 0.32
66 0.37
67 0.41
68 0.49
69 0.52
70 0.54
71 0.58
72 0.55
73 0.6
74 0.64
75 0.68
76 0.62
77 0.66
78 0.65
79 0.64
80 0.64
81 0.61
82 0.59
83 0.55
84 0.58
85 0.6
86 0.6
87 0.58
88 0.55
89 0.54
90 0.53
91 0.58
92 0.6
93 0.61
94 0.68
95 0.75