Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7WDC1

Protein Details
Accession S7WDC1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-103LPSFIKDEKKPNQKPERSLNSKYKNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 4, golg 3, vacu 3, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNTMQNDLPPNPFSFPVCSFVIGVCAGVYSFVVGAGAGIGVSVGCVCSFVVGADIRPVPPCIVLILKNIKKFKIQHKILPSFIKDEKKPNQKPERSLNSKYKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.26
4 0.25
5 0.24
6 0.22
7 0.2
8 0.2
9 0.15
10 0.13
11 0.08
12 0.07
13 0.06
14 0.06
15 0.06
16 0.04
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.05
38 0.05
39 0.05
40 0.07
41 0.07
42 0.07
43 0.08
44 0.09
45 0.08
46 0.08
47 0.08
48 0.07
49 0.09
50 0.1
51 0.13
52 0.22
53 0.26
54 0.32
55 0.34
56 0.34
57 0.38
58 0.43
59 0.49
60 0.5
61 0.52
62 0.53
63 0.61
64 0.65
65 0.65
66 0.64
67 0.56
68 0.51
69 0.53
70 0.53
71 0.46
72 0.5
73 0.55
74 0.6
75 0.66
76 0.71
77 0.76
78 0.76
79 0.81
80 0.82
81 0.83
82 0.81
83 0.81