Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7WAR1

Protein Details
Accession S7WAR1    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
135-159KEYLAFIKKNRKQTKPKFNSNDLLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 8.833, mito 8.5, cyto_mito 7.833, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR041247  Rad52_fam  
IPR007232  Rad52_Rad59_Rad22  
IPR042525  Rad52_Rad59_Rad22_sf  
Gene Ontology GO:0006310  P:DNA recombination  
GO:0006302  P:double-strand break repair  
Pfam View protein in Pfam  
PF04098  Rad52_Rad22  
Amino Acid Sequences MKKCSISKTLDKRLSPEYISYRRAWGETEVAYIEGWSAIAIANKIFGYNGWSSTIKEIKIDFIEEVNKKFIISVSCIVTITLKDGTQREDVGCGSSESKNKIIGIEKAKKEAATDAIKRTLRQFGNALGNCCYDKEYLAFIKKNRKQTKPKFNSNDLLDRNFIYENQDSSEIDILASFNSEAYKDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.53
3 0.49
4 0.47
5 0.46
6 0.49
7 0.46
8 0.44
9 0.41
10 0.4
11 0.35
12 0.29
13 0.26
14 0.22
15 0.23
16 0.19
17 0.18
18 0.17
19 0.15
20 0.12
21 0.07
22 0.07
23 0.05
24 0.04
25 0.04
26 0.06
27 0.06
28 0.06
29 0.07
30 0.07
31 0.08
32 0.07
33 0.07
34 0.1
35 0.11
36 0.12
37 0.14
38 0.15
39 0.16
40 0.21
41 0.24
42 0.19
43 0.2
44 0.2
45 0.19
46 0.19
47 0.19
48 0.15
49 0.13
50 0.19
51 0.19
52 0.21
53 0.2
54 0.19
55 0.18
56 0.17
57 0.17
58 0.13
59 0.14
60 0.15
61 0.15
62 0.15
63 0.15
64 0.15
65 0.14
66 0.12
67 0.11
68 0.09
69 0.08
70 0.09
71 0.1
72 0.13
73 0.14
74 0.14
75 0.13
76 0.13
77 0.13
78 0.12
79 0.11
80 0.09
81 0.1
82 0.12
83 0.14
84 0.15
85 0.16
86 0.16
87 0.16
88 0.17
89 0.18
90 0.21
91 0.27
92 0.32
93 0.32
94 0.34
95 0.35
96 0.33
97 0.31
98 0.27
99 0.24
100 0.22
101 0.24
102 0.24
103 0.31
104 0.32
105 0.32
106 0.33
107 0.35
108 0.29
109 0.29
110 0.28
111 0.26
112 0.35
113 0.36
114 0.35
115 0.29
116 0.3
117 0.27
118 0.26
119 0.23
120 0.13
121 0.13
122 0.12
123 0.14
124 0.18
125 0.24
126 0.27
127 0.31
128 0.41
129 0.46
130 0.56
131 0.61
132 0.66
133 0.71
134 0.78
135 0.85
136 0.84
137 0.89
138 0.86
139 0.84
140 0.83
141 0.77
142 0.76
143 0.68
144 0.62
145 0.52
146 0.44
147 0.4
148 0.32
149 0.27
150 0.23
151 0.22
152 0.2
153 0.21
154 0.23
155 0.21
156 0.22
157 0.24
158 0.18
159 0.15
160 0.14
161 0.12
162 0.1
163 0.11
164 0.08
165 0.07
166 0.07