Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7XTS8

Protein Details
Accession S7XTS8    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-117KIYYILTKEKNNKNKKKEKNREIEKLEGFHydrophilic
NLS Segment(s)
PositionSequence
98-109KNNKNKKKEKNR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MKKSIQNKIDDLISLRKALDDNLDTDYTYLLENKTQEQILEKCMLRLEILNVNKNYKVKVREKIKIVQQGNLKKRIEEIIKNKKIFDDKIYYILTKEKNNKNKKKEKNREIEKLEGFVERKEDEMWSDDKIDELYKILLNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.23
4 0.21
5 0.21
6 0.23
7 0.18
8 0.18
9 0.2
10 0.21
11 0.2
12 0.19
13 0.18
14 0.13
15 0.12
16 0.12
17 0.08
18 0.11
19 0.12
20 0.14
21 0.16
22 0.16
23 0.15
24 0.19
25 0.19
26 0.2
27 0.24
28 0.22
29 0.21
30 0.21
31 0.21
32 0.16
33 0.16
34 0.15
35 0.17
36 0.2
37 0.25
38 0.26
39 0.27
40 0.29
41 0.3
42 0.29
43 0.27
44 0.31
45 0.32
46 0.39
47 0.45
48 0.48
49 0.52
50 0.56
51 0.57
52 0.59
53 0.53
54 0.49
55 0.49
56 0.51
57 0.52
58 0.54
59 0.47
60 0.38
61 0.38
62 0.38
63 0.35
64 0.34
65 0.39
66 0.43
67 0.5
68 0.5
69 0.5
70 0.48
71 0.48
72 0.42
73 0.37
74 0.32
75 0.26
76 0.3
77 0.31
78 0.29
79 0.26
80 0.3
81 0.28
82 0.28
83 0.36
84 0.41
85 0.5
86 0.61
87 0.7
88 0.75
89 0.82
90 0.86
91 0.89
92 0.91
93 0.91
94 0.91
95 0.91
96 0.9
97 0.85
98 0.82
99 0.73
100 0.63
101 0.54
102 0.48
103 0.39
104 0.3
105 0.28
106 0.21
107 0.2
108 0.19
109 0.18
110 0.16
111 0.18
112 0.19
113 0.17
114 0.19
115 0.17
116 0.17
117 0.17
118 0.17
119 0.14
120 0.14
121 0.14
122 0.15