Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RN43

Protein Details
Accession F4RN43   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-30GRSIPCIGSQHKPKRQRADTQATIEKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041320  CxC1  
IPR040521  KDZ  
KEGG mlr:MELLADRAFT_71976  -  
Pfam View protein in Pfam  
PF18802  CxC1  
PF18758  KDZ  
Amino Acid Sequences MGTSGRSIPCIGSQHKPKRQRADTQATIEKAERDQAQKEWGQRKCESISHALNDPSRNSEHTANLDPINQQQEAPEIMHNDFNYSGFPDEDERDQELFQDLGQESDQEEMHTYVRYFSRDTYKHQKIQEDIHWKSTMQRVFIAFMKAVKQTSNGGDHSLWDHNFNTVEICSCGPSRKRTRLVDTVDLLYRRQLKVEFCSCTPDQVRLLNQGYFGASPKTPETAFSLRLLRLYHLAWKYCHSNIQPFSLMIDEFLDAFNPQLLVPGTYEPRLWRKPLASAVYYYRQILKMIEDLEAQSLNLTPLEKLACNCPRCFGPAGCSPIKKGPQYIVCVDDEVARWEPQQSGNGRTEVPLDPCTTQHTAAEDRRDGSSWRGSEETGLIGLACRHDHMLKIVNVIRSGEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.73
4 0.77
5 0.81
6 0.85
7 0.86
8 0.86
9 0.85
10 0.83
11 0.81
12 0.79
13 0.69
14 0.64
15 0.56
16 0.48
17 0.39
18 0.37
19 0.34
20 0.31
21 0.33
22 0.33
23 0.38
24 0.4
25 0.47
26 0.51
27 0.51
28 0.53
29 0.52
30 0.55
31 0.52
32 0.52
33 0.48
34 0.47
35 0.47
36 0.44
37 0.46
38 0.45
39 0.45
40 0.44
41 0.41
42 0.37
43 0.33
44 0.32
45 0.31
46 0.31
47 0.31
48 0.32
49 0.35
50 0.33
51 0.32
52 0.32
53 0.29
54 0.3
55 0.3
56 0.25
57 0.21
58 0.19
59 0.2
60 0.19
61 0.19
62 0.17
63 0.16
64 0.17
65 0.2
66 0.19
67 0.19
68 0.18
69 0.16
70 0.15
71 0.14
72 0.14
73 0.11
74 0.12
75 0.13
76 0.15
77 0.17
78 0.19
79 0.21
80 0.21
81 0.2
82 0.2
83 0.19
84 0.16
85 0.14
86 0.16
87 0.13
88 0.13
89 0.13
90 0.12
91 0.11
92 0.13
93 0.13
94 0.08
95 0.1
96 0.1
97 0.11
98 0.12
99 0.11
100 0.13
101 0.15
102 0.17
103 0.16
104 0.19
105 0.27
106 0.29
107 0.36
108 0.43
109 0.49
110 0.54
111 0.57
112 0.58
113 0.52
114 0.55
115 0.56
116 0.55
117 0.49
118 0.47
119 0.44
120 0.39
121 0.4
122 0.4
123 0.34
124 0.26
125 0.26
126 0.23
127 0.24
128 0.26
129 0.24
130 0.18
131 0.17
132 0.18
133 0.17
134 0.17
135 0.15
136 0.14
137 0.15
138 0.17
139 0.2
140 0.18
141 0.19
142 0.18
143 0.18
144 0.2
145 0.2
146 0.18
147 0.16
148 0.16
149 0.15
150 0.15
151 0.14
152 0.12
153 0.09
154 0.1
155 0.09
156 0.09
157 0.09
158 0.09
159 0.14
160 0.16
161 0.25
162 0.33
163 0.4
164 0.47
165 0.51
166 0.57
167 0.6
168 0.62
169 0.58
170 0.51
171 0.45
172 0.4
173 0.35
174 0.29
175 0.24
176 0.23
177 0.18
178 0.18
179 0.18
180 0.18
181 0.23
182 0.28
183 0.27
184 0.23
185 0.28
186 0.27
187 0.29
188 0.28
189 0.24
190 0.21
191 0.21
192 0.22
193 0.22
194 0.23
195 0.19
196 0.19
197 0.17
198 0.16
199 0.14
200 0.13
201 0.1
202 0.08
203 0.09
204 0.1
205 0.11
206 0.1
207 0.11
208 0.16
209 0.17
210 0.18
211 0.19
212 0.21
213 0.2
214 0.22
215 0.21
216 0.17
217 0.16
218 0.15
219 0.2
220 0.2
221 0.22
222 0.21
223 0.23
224 0.26
225 0.25
226 0.29
227 0.24
228 0.29
229 0.28
230 0.31
231 0.3
232 0.26
233 0.26
234 0.22
235 0.2
236 0.12
237 0.11
238 0.07
239 0.07
240 0.06
241 0.06
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.07
248 0.07
249 0.07
250 0.08
251 0.11
252 0.12
253 0.13
254 0.14
255 0.15
256 0.22
257 0.25
258 0.27
259 0.28
260 0.28
261 0.33
262 0.38
263 0.4
264 0.33
265 0.33
266 0.35
267 0.36
268 0.35
269 0.31
270 0.27
271 0.24
272 0.23
273 0.21
274 0.18
275 0.17
276 0.17
277 0.17
278 0.14
279 0.14
280 0.14
281 0.14
282 0.12
283 0.09
284 0.08
285 0.08
286 0.08
287 0.08
288 0.06
289 0.08
290 0.11
291 0.12
292 0.12
293 0.21
294 0.28
295 0.31
296 0.31
297 0.32
298 0.31
299 0.34
300 0.37
301 0.3
302 0.27
303 0.31
304 0.37
305 0.39
306 0.39
307 0.39
308 0.42
309 0.47
310 0.44
311 0.4
312 0.41
313 0.42
314 0.46
315 0.45
316 0.41
317 0.36
318 0.34
319 0.32
320 0.27
321 0.22
322 0.21
323 0.21
324 0.18
325 0.18
326 0.18
327 0.2
328 0.2
329 0.26
330 0.25
331 0.28
332 0.31
333 0.32
334 0.31
335 0.29
336 0.31
337 0.27
338 0.28
339 0.25
340 0.24
341 0.23
342 0.24
343 0.29
344 0.28
345 0.26
346 0.24
347 0.26
348 0.3
349 0.35
350 0.41
351 0.38
352 0.37
353 0.38
354 0.38
355 0.35
356 0.33
357 0.36
358 0.3
359 0.31
360 0.31
361 0.29
362 0.29
363 0.29
364 0.24
365 0.16
366 0.15
367 0.11
368 0.11
369 0.12
370 0.12
371 0.11
372 0.11
373 0.14
374 0.16
375 0.18
376 0.22
377 0.28
378 0.28
379 0.35
380 0.38
381 0.38
382 0.38