Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7W629

Protein Details
Accession S7W629    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
195-227NEEKKMLVIKKQKKVKKHKRKIKLTNTHVKGLDBasic
NLS Segment(s)
PositionSequence
203-217IKKQKKVKKHKRKIK
Subcellular Location(s) nucl 11, cyto_nucl 9.5, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016656  TFIIE-bsu  
IPR003166  TFIIE_bsu_DNA-bd  
Gene Ontology GO:0005673  C:transcription factor TFIIE complex  
GO:0003743  F:translation initiation factor activity  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF02186  TFIIE_beta  
PROSITE View protein in PROSITE  
PS51351  TFIIE_BETA_C  
Amino Acid Sequences MIKSINKYFFNIFYTLTYTQNPMGFDTPYNHTERKHINTYIHDILKFLKTKDSNVDIREVSRNIGIDIGKDKELLSYISKNPRIKYKNNSLEFIPEYVANSVNDLRKILMDLKKCVEMRKLLDTNKPIQSYIDELLSKGEIFIIKDIDGEEIVFYNDMVVDSLPENIKDLYFSIKVPVYQDILRELNAAGMKVDNEEKKMLVIKKQKKVKKHKRKIKLTNTHVKGLDLGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.27
4 0.25
5 0.24
6 0.26
7 0.27
8 0.26
9 0.23
10 0.23
11 0.22
12 0.22
13 0.23
14 0.25
15 0.26
16 0.31
17 0.3
18 0.29
19 0.35
20 0.41
21 0.44
22 0.46
23 0.46
24 0.46
25 0.49
26 0.55
27 0.55
28 0.51
29 0.43
30 0.37
31 0.36
32 0.37
33 0.35
34 0.28
35 0.29
36 0.27
37 0.3
38 0.36
39 0.39
40 0.38
41 0.37
42 0.4
43 0.33
44 0.34
45 0.36
46 0.3
47 0.25
48 0.22
49 0.21
50 0.17
51 0.18
52 0.16
53 0.12
54 0.15
55 0.16
56 0.14
57 0.14
58 0.14
59 0.12
60 0.13
61 0.13
62 0.13
63 0.15
64 0.2
65 0.28
66 0.35
67 0.38
68 0.39
69 0.47
70 0.49
71 0.52
72 0.55
73 0.58
74 0.61
75 0.6
76 0.6
77 0.51
78 0.5
79 0.44
80 0.37
81 0.26
82 0.16
83 0.14
84 0.13
85 0.14
86 0.09
87 0.1
88 0.11
89 0.12
90 0.12
91 0.12
92 0.11
93 0.1
94 0.11
95 0.16
96 0.18
97 0.19
98 0.21
99 0.22
100 0.27
101 0.27
102 0.27
103 0.24
104 0.23
105 0.23
106 0.29
107 0.32
108 0.29
109 0.34
110 0.35
111 0.37
112 0.39
113 0.37
114 0.29
115 0.25
116 0.24
117 0.22
118 0.2
119 0.18
120 0.13
121 0.12
122 0.13
123 0.13
124 0.11
125 0.08
126 0.08
127 0.06
128 0.06
129 0.07
130 0.07
131 0.07
132 0.08
133 0.08
134 0.08
135 0.07
136 0.06
137 0.06
138 0.05
139 0.05
140 0.05
141 0.05
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.05
149 0.08
150 0.08
151 0.08
152 0.09
153 0.09
154 0.09
155 0.09
156 0.09
157 0.12
158 0.12
159 0.13
160 0.14
161 0.15
162 0.16
163 0.18
164 0.19
165 0.18
166 0.18
167 0.19
168 0.2
169 0.2
170 0.19
171 0.19
172 0.16
173 0.17
174 0.17
175 0.16
176 0.11
177 0.11
178 0.11
179 0.12
180 0.18
181 0.17
182 0.18
183 0.2
184 0.19
185 0.21
186 0.27
187 0.29
188 0.32
189 0.41
190 0.48
191 0.56
192 0.66
193 0.7
194 0.74
195 0.83
196 0.85
197 0.86
198 0.88
199 0.89
200 0.9
201 0.95
202 0.96
203 0.96
204 0.95
205 0.93
206 0.93
207 0.87
208 0.84
209 0.73
210 0.63