Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7XVU8

Protein Details
Accession S7XVU8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
52-76VFENDRKTKTKKKSVNKSKDKPVEEHydrophilic
NLS Segment(s)
PositionSequence
59-68TKTKKKSVNK
Subcellular Location(s) cyto 13.5, cyto_nucl 12.5, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR017984  Chromo_dom_subgr  
IPR023780  Chromo_domain  
IPR008251  Chromo_shadow_dom  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF00385  Chromo  
PF01393  Chromo_shadow  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
Amino Acid Sequences MPSDNVYNVEKIVDVRVVKGRKQYLIKWEGYPDSENTWQFASDIFCKDLITVFENDRKTKTKKKSVNKSKDKPVEEEVVITNAWDKQVLKVIQVQPVSENSKELEVLVEFKNGKVIGAPLKDVHAKCPLKLLKYYEENLSFAED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.25
4 0.28
5 0.31
6 0.38
7 0.4
8 0.42
9 0.47
10 0.49
11 0.51
12 0.54
13 0.54
14 0.48
15 0.48
16 0.43
17 0.4
18 0.37
19 0.29
20 0.27
21 0.29
22 0.27
23 0.25
24 0.23
25 0.2
26 0.18
27 0.18
28 0.16
29 0.14
30 0.16
31 0.15
32 0.15
33 0.15
34 0.15
35 0.15
36 0.13
37 0.13
38 0.13
39 0.14
40 0.19
41 0.22
42 0.23
43 0.25
44 0.29
45 0.32
46 0.4
47 0.47
48 0.52
49 0.59
50 0.68
51 0.76
52 0.82
53 0.87
54 0.88
55 0.86
56 0.86
57 0.85
58 0.76
59 0.68
60 0.6
61 0.53
62 0.42
63 0.36
64 0.26
65 0.19
66 0.17
67 0.13
68 0.11
69 0.08
70 0.07
71 0.07
72 0.07
73 0.07
74 0.14
75 0.15
76 0.15
77 0.21
78 0.24
79 0.27
80 0.27
81 0.27
82 0.21
83 0.25
84 0.28
85 0.21
86 0.2
87 0.16
88 0.16
89 0.16
90 0.14
91 0.12
92 0.09
93 0.12
94 0.11
95 0.15
96 0.14
97 0.14
98 0.18
99 0.16
100 0.16
101 0.13
102 0.15
103 0.17
104 0.19
105 0.2
106 0.18
107 0.21
108 0.28
109 0.27
110 0.28
111 0.32
112 0.33
113 0.31
114 0.4
115 0.42
116 0.39
117 0.44
118 0.46
119 0.44
120 0.49
121 0.51
122 0.49
123 0.47
124 0.44