Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7W7C6

Protein Details
Accession S7W7C6    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-34VRRGSTFNTRSNKRKKVRTPGNRLVFQDHydrophilic
NLS Segment(s)
PositionSequence
18-29NKRKKVRTPGNR
36-41KKKGKG
Subcellular Location(s) nucl 15, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MVERQVVRRGSTFNTRSNKRKKVRTPGNRLVFQDVKKKGKGPKCGQCGIKLAGVKEARPAAFSRMRKSCRKVNRILGGVQCAKCVQEKVLDAFLNAEEKRMKELEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.56
3 0.63
4 0.71
5 0.76
6 0.75
7 0.81
8 0.83
9 0.84
10 0.88
11 0.89
12 0.89
13 0.89
14 0.88
15 0.82
16 0.75
17 0.7
18 0.64
19 0.57
20 0.55
21 0.52
22 0.48
23 0.45
24 0.48
25 0.49
26 0.52
27 0.59
28 0.59
29 0.61
30 0.62
31 0.66
32 0.62
33 0.57
34 0.54
35 0.45
36 0.39
37 0.31
38 0.25
39 0.25
40 0.24
41 0.21
42 0.2
43 0.2
44 0.16
45 0.16
46 0.17
47 0.16
48 0.23
49 0.26
50 0.29
51 0.36
52 0.41
53 0.48
54 0.52
55 0.56
56 0.59
57 0.64
58 0.66
59 0.67
60 0.69
61 0.65
62 0.63
63 0.57
64 0.53
65 0.51
66 0.43
67 0.35
68 0.28
69 0.26
70 0.25
71 0.24
72 0.19
73 0.18
74 0.21
75 0.23
76 0.28
77 0.27
78 0.25
79 0.25
80 0.24
81 0.25
82 0.22
83 0.22
84 0.2
85 0.21
86 0.25