Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7W9Q5

Protein Details
Accession S7W9Q5    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
45-97VSKTPKKCTSIKKKENNIPNSLYKNLRNNKIKNKKLSNKNLRNNKIKNKNLSNHydrophilic
NLS Segment(s)
PositionSequence
74-90KIKNKKLSNKNLRNNKI
Subcellular Location(s) mito 13, nucl 9, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFSLHIYQNIIFIFLYIIHLQSYKPKKDIFTLDNTINPIVINYIVSKTPKKCTSIKKKENNIPNSLYKNLRNNKIKNKKLSNKNLRNNKIKNKNLSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.12
3 0.09
4 0.1
5 0.09
6 0.1
7 0.1
8 0.19
9 0.27
10 0.28
11 0.31
12 0.33
13 0.34
14 0.39
15 0.46
16 0.4
17 0.4
18 0.4
19 0.38
20 0.37
21 0.37
22 0.31
23 0.24
24 0.2
25 0.13
26 0.09
27 0.07
28 0.06
29 0.05
30 0.06
31 0.08
32 0.1
33 0.14
34 0.15
35 0.21
36 0.24
37 0.27
38 0.33
39 0.42
40 0.52
41 0.59
42 0.67
43 0.71
44 0.78
45 0.81
46 0.84
47 0.79
48 0.73
49 0.66
50 0.62
51 0.56
52 0.51
53 0.47
54 0.43
55 0.47
56 0.49
57 0.54
58 0.57
59 0.61
60 0.69
61 0.75
62 0.79
63 0.79
64 0.83
65 0.84
66 0.86
67 0.89
68 0.89
69 0.89
70 0.91
71 0.92
72 0.9
73 0.9
74 0.89
75 0.89
76 0.89
77 0.87