Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7W9M7

Protein Details
Accession S7W9M7    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTKKRSNNGRSKKNRGHTRCVRCEHCHydrophilic
80-102HIKLVRVRSRWERKIRKEQRVSAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 13.333, nucl 8, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MTKKRSNNGRSKKNRGHTRCVRCEHCSAMVPNDKAIKKFVVRSVIDAASLDDLKIATIYEEYEVPKSYYKLNYCVSCAVHIKLVRVRSRWERKIRKEQRVSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.87
3 0.87
4 0.87
5 0.87
6 0.85
7 0.84
8 0.79
9 0.72
10 0.69
11 0.62
12 0.54
13 0.48
14 0.4
15 0.39
16 0.41
17 0.36
18 0.35
19 0.38
20 0.36
21 0.32
22 0.32
23 0.29
24 0.24
25 0.27
26 0.28
27 0.29
28 0.28
29 0.3
30 0.31
31 0.28
32 0.26
33 0.22
34 0.19
35 0.12
36 0.12
37 0.09
38 0.05
39 0.05
40 0.05
41 0.05
42 0.04
43 0.03
44 0.03
45 0.04
46 0.05
47 0.06
48 0.07
49 0.08
50 0.09
51 0.1
52 0.12
53 0.13
54 0.16
55 0.21
56 0.22
57 0.27
58 0.31
59 0.31
60 0.32
61 0.34
62 0.31
63 0.29
64 0.3
65 0.25
66 0.26
67 0.26
68 0.28
69 0.28
70 0.35
71 0.37
72 0.37
73 0.43
74 0.48
75 0.58
76 0.63
77 0.7
78 0.74
79 0.78
80 0.88
81 0.91
82 0.91