Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7W528

Protein Details
Accession S7W528    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-35NSQVRILLNKKEKKRNKLVIKFSNSIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MKEYNVLINNSQVRILLNKKEKKRNKLVIKFSNSINLLSNIVSKILEKRIYNKIQLMVKFEDMMNMDLIGHKNILQNINTKEYNAIYNFEPINNYRENEYVKFYELIRNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.31
4 0.38
5 0.46
6 0.54
7 0.65
8 0.73
9 0.77
10 0.83
11 0.84
12 0.85
13 0.86
14 0.88
15 0.86
16 0.84
17 0.77
18 0.67
19 0.63
20 0.53
21 0.44
22 0.35
23 0.27
24 0.2
25 0.18
26 0.18
27 0.11
28 0.11
29 0.1
30 0.09
31 0.1
32 0.14
33 0.17
34 0.17
35 0.21
36 0.29
37 0.32
38 0.34
39 0.33
40 0.33
41 0.33
42 0.34
43 0.33
44 0.26
45 0.24
46 0.22
47 0.2
48 0.17
49 0.14
50 0.14
51 0.1
52 0.08
53 0.08
54 0.09
55 0.1
56 0.08
57 0.08
58 0.08
59 0.1
60 0.13
61 0.16
62 0.15
63 0.21
64 0.23
65 0.29
66 0.28
67 0.26
68 0.25
69 0.24
70 0.26
71 0.21
72 0.21
73 0.16
74 0.2
75 0.2
76 0.19
77 0.21
78 0.19
79 0.22
80 0.23
81 0.23
82 0.21
83 0.25
84 0.29
85 0.28
86 0.32
87 0.3
88 0.3
89 0.3
90 0.29