Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4SD45

Protein Details
Accession F4SD45   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
35-58LELVNKKQRRKGNHKPRGYFHKIFBasic
NLS Segment(s)
PositionSequence
40-51KKQRRKGNHKPR
209-215GRRSKKK
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
KEGG mlr:MELLADRAFT_69998  -  
Amino Acid Sequences MEAPLRKNSEVFRLESIAFDARARKVVNKLLADDLELVNKKQRRKGNHKPRGYFHKIFFTPADWSTLEELTTELAPFLDLTKCMEGDGPTGCLVIPEFYALKFHLASRVEELSLVPGNLFQLFKSHDPEVESNEIAAYLKATHPMASNDDARKTKAVLPWWRIYAFGTGSDLVPGAIEYCVGSRLGGRQRVPLGHKYKEANEAIEAFGGRRSKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.32
4 0.25
5 0.22
6 0.21
7 0.22
8 0.2
9 0.24
10 0.25
11 0.26
12 0.3
13 0.36
14 0.41
15 0.4
16 0.41
17 0.4
18 0.38
19 0.36
20 0.32
21 0.25
22 0.24
23 0.23
24 0.21
25 0.25
26 0.29
27 0.32
28 0.38
29 0.45
30 0.49
31 0.58
32 0.68
33 0.73
34 0.79
35 0.83
36 0.83
37 0.83
38 0.83
39 0.82
40 0.76
41 0.68
42 0.67
43 0.58
44 0.54
45 0.47
46 0.39
47 0.33
48 0.28
49 0.28
50 0.18
51 0.19
52 0.18
53 0.18
54 0.15
55 0.12
56 0.11
57 0.09
58 0.09
59 0.07
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.08
68 0.09
69 0.09
70 0.09
71 0.1
72 0.09
73 0.1
74 0.1
75 0.09
76 0.09
77 0.09
78 0.08
79 0.07
80 0.07
81 0.06
82 0.05
83 0.05
84 0.05
85 0.05
86 0.06
87 0.07
88 0.08
89 0.08
90 0.08
91 0.12
92 0.12
93 0.13
94 0.15
95 0.15
96 0.14
97 0.14
98 0.13
99 0.1
100 0.1
101 0.09
102 0.06
103 0.05
104 0.06
105 0.07
106 0.07
107 0.05
108 0.07
109 0.1
110 0.11
111 0.15
112 0.15
113 0.15
114 0.18
115 0.19
116 0.21
117 0.21
118 0.2
119 0.16
120 0.15
121 0.14
122 0.11
123 0.1
124 0.07
125 0.05
126 0.05
127 0.08
128 0.08
129 0.09
130 0.1
131 0.12
132 0.15
133 0.17
134 0.22
135 0.22
136 0.28
137 0.28
138 0.28
139 0.28
140 0.27
141 0.28
142 0.27
143 0.34
144 0.36
145 0.41
146 0.44
147 0.46
148 0.44
149 0.4
150 0.37
151 0.32
152 0.24
153 0.19
154 0.17
155 0.14
156 0.14
157 0.14
158 0.12
159 0.09
160 0.08
161 0.07
162 0.06
163 0.05
164 0.05
165 0.05
166 0.05
167 0.07
168 0.07
169 0.07
170 0.07
171 0.14
172 0.22
173 0.28
174 0.29
175 0.34
176 0.38
177 0.44
178 0.48
179 0.5
180 0.5
181 0.49
182 0.53
183 0.52
184 0.52
185 0.55
186 0.51
187 0.44
188 0.4
189 0.36
190 0.31
191 0.28
192 0.25
193 0.17
194 0.19
195 0.22