Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4SD06

Protein Details
Accession F4SD06   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
139-172SVPKASKTTGQPPKKRARAPPKSKNKKSASIPETHydrophilic
NLS Segment(s)
PositionSequence
148-166GQPPKKRARAPPKSKNKKS
Subcellular Location(s) nucl 18.5, cyto_nucl 14.5, cyto 7.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_69975  -  
Amino Acid Sequences MSAASPPTHHSIYLSGNFEIENRVSPITIAGSGPEYTTYAVSIGCRGGDRDARLLYEIRATESNNSPAPPKAKTDGNGIPSKKPVKFVSRAVSSPFISPIPASSSSQTLVSGSGEVSQLAVESGSGSSPALSLPSTSSSVPKASKTTGQPPKKRARAPPKSKNKKSASIPETL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.26
3 0.26
4 0.25
5 0.24
6 0.24
7 0.19
8 0.15
9 0.14
10 0.14
11 0.14
12 0.14
13 0.14
14 0.13
15 0.13
16 0.1
17 0.09
18 0.11
19 0.11
20 0.11
21 0.11
22 0.1
23 0.1
24 0.1
25 0.09
26 0.08
27 0.08
28 0.08
29 0.08
30 0.08
31 0.08
32 0.08
33 0.09
34 0.12
35 0.15
36 0.17
37 0.19
38 0.2
39 0.2
40 0.21
41 0.21
42 0.18
43 0.18
44 0.16
45 0.14
46 0.15
47 0.15
48 0.17
49 0.19
50 0.22
51 0.19
52 0.2
53 0.19
54 0.2
55 0.22
56 0.2
57 0.2
58 0.2
59 0.22
60 0.23
61 0.28
62 0.29
63 0.32
64 0.36
65 0.35
66 0.33
67 0.35
68 0.38
69 0.32
70 0.32
71 0.31
72 0.31
73 0.34
74 0.37
75 0.38
76 0.37
77 0.37
78 0.35
79 0.35
80 0.3
81 0.26
82 0.23
83 0.16
84 0.13
85 0.12
86 0.11
87 0.11
88 0.12
89 0.13
90 0.13
91 0.14
92 0.14
93 0.15
94 0.14
95 0.1
96 0.09
97 0.08
98 0.07
99 0.06
100 0.07
101 0.07
102 0.06
103 0.06
104 0.05
105 0.05
106 0.05
107 0.04
108 0.03
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.05
117 0.05
118 0.05
119 0.06
120 0.07
121 0.1
122 0.12
123 0.12
124 0.14
125 0.15
126 0.2
127 0.21
128 0.23
129 0.23
130 0.25
131 0.3
132 0.34
133 0.43
134 0.49
135 0.58
136 0.63
137 0.69
138 0.77
139 0.8
140 0.82
141 0.82
142 0.83
143 0.84
144 0.87
145 0.89
146 0.89
147 0.91
148 0.93
149 0.93
150 0.89
151 0.87
152 0.85
153 0.85