Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RIE4

Protein Details
Accession F4RIE4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
261-284APTPPAPRRSLRTRKEPERYGFTKHydrophilic
NLS Segment(s)
PositionSequence
272-275RTRK
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_105746  -  
Amino Acid Sequences MTKGQDPPIVPDDPITEVVKSPGSGPTNDLDTQLPIIIEDESDRSSSPPQFCPRVLIPLSGSIHAPPVNSTQQTPHVDLTQSRTSISPNRQSKLPSPIQSPPNQSEVQRLPSELVQQRYRSISPPSSHSSASPIALTPVGSPVSSANSPIIPGSNSSSELSSIPDEVHEFVQSSPEASPNASLRSSPKESPRPSIQSSPKVSSSASPKARTPTPPPQHVQVPTPTPSPVVQPQPKTPAAQPTPASVPPSLETRDQPSEQHAPTPPAPRRSLRTRKEPERYGFTKKTAKLARLPWQPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.23
3 0.19
4 0.18
5 0.2
6 0.2
7 0.18
8 0.16
9 0.2
10 0.21
11 0.21
12 0.23
13 0.23
14 0.26
15 0.26
16 0.27
17 0.21
18 0.2
19 0.2
20 0.18
21 0.15
22 0.11
23 0.11
24 0.1
25 0.09
26 0.09
27 0.1
28 0.1
29 0.11
30 0.11
31 0.12
32 0.17
33 0.23
34 0.26
35 0.31
36 0.37
37 0.41
38 0.41
39 0.45
40 0.42
41 0.44
42 0.41
43 0.36
44 0.3
45 0.33
46 0.34
47 0.28
48 0.27
49 0.19
50 0.21
51 0.19
52 0.18
53 0.13
54 0.16
55 0.2
56 0.21
57 0.21
58 0.22
59 0.29
60 0.32
61 0.33
62 0.3
63 0.27
64 0.28
65 0.28
66 0.32
67 0.29
68 0.25
69 0.23
70 0.22
71 0.24
72 0.29
73 0.35
74 0.38
75 0.4
76 0.42
77 0.43
78 0.47
79 0.48
80 0.5
81 0.5
82 0.44
83 0.42
84 0.47
85 0.5
86 0.52
87 0.52
88 0.46
89 0.43
90 0.41
91 0.37
92 0.37
93 0.34
94 0.34
95 0.29
96 0.26
97 0.23
98 0.23
99 0.29
100 0.26
101 0.29
102 0.28
103 0.28
104 0.3
105 0.32
106 0.32
107 0.27
108 0.27
109 0.28
110 0.25
111 0.29
112 0.32
113 0.31
114 0.3
115 0.28
116 0.27
117 0.23
118 0.22
119 0.17
120 0.12
121 0.11
122 0.1
123 0.1
124 0.07
125 0.07
126 0.07
127 0.06
128 0.07
129 0.06
130 0.09
131 0.09
132 0.09
133 0.08
134 0.08
135 0.08
136 0.08
137 0.08
138 0.06
139 0.07
140 0.08
141 0.08
142 0.1
143 0.1
144 0.11
145 0.11
146 0.11
147 0.11
148 0.1
149 0.09
150 0.07
151 0.07
152 0.08
153 0.08
154 0.08
155 0.07
156 0.08
157 0.07
158 0.09
159 0.09
160 0.09
161 0.08
162 0.09
163 0.09
164 0.09
165 0.11
166 0.1
167 0.13
168 0.12
169 0.12
170 0.14
171 0.2
172 0.24
173 0.26
174 0.32
175 0.4
176 0.42
177 0.48
178 0.52
179 0.52
180 0.51
181 0.57
182 0.56
183 0.55
184 0.57
185 0.54
186 0.49
187 0.44
188 0.4
189 0.35
190 0.35
191 0.36
192 0.37
193 0.36
194 0.37
195 0.4
196 0.44
197 0.45
198 0.46
199 0.48
200 0.5
201 0.55
202 0.55
203 0.55
204 0.57
205 0.55
206 0.5
207 0.44
208 0.41
209 0.37
210 0.35
211 0.31
212 0.27
213 0.25
214 0.26
215 0.26
216 0.32
217 0.36
218 0.39
219 0.43
220 0.48
221 0.5
222 0.48
223 0.45
224 0.46
225 0.42
226 0.44
227 0.4
228 0.38
229 0.4
230 0.39
231 0.39
232 0.29
233 0.28
234 0.24
235 0.27
236 0.25
237 0.24
238 0.24
239 0.28
240 0.34
241 0.33
242 0.32
243 0.35
244 0.4
245 0.38
246 0.4
247 0.37
248 0.37
249 0.41
250 0.49
251 0.5
252 0.49
253 0.54
254 0.54
255 0.58
256 0.64
257 0.69
258 0.68
259 0.72
260 0.76
261 0.81
262 0.85
263 0.87
264 0.83
265 0.82
266 0.79
267 0.77
268 0.73
269 0.7
270 0.69
271 0.62
272 0.65
273 0.63
274 0.63
275 0.61
276 0.64
277 0.67