Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5AB69

Protein Details
Accession Q5AB69    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
214-240LERNRIAASKCRQRKKQEQVQIQNNIAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0000785  C:chromatin  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0071244  P:cellular response to carbon dioxide  
GO:0030447  P:filamentous growth  
GO:0031505  P:fungal-type cell wall organization  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG cal:CAALFM_C100080CA  -  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences MEELKDAREERSVCWASCRTSSSSVDDMTTPLFLHRKKIEGIFFFLSVSQLSLPAMNFPPFEQPLFDPNQAELLEEAERAKNSSIPFHNPFDVNSYPITNPPIFDSTMTVPYTTDGVPRRRRISISNGQIGQIVSHEAYFAEDLDVPPEFESRPQTSVIEPPPPPPPQPQPQLPVEIAGVPPPNHQLIYNNEVIYNPENGPIPGTAAWKKERLLERNRIAASKCRQRKKQEQVQIQNNIAKMEKELKKKDAKIAELEYTVELLKASIKSCIEDGNTDRLKQFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.37
4 0.4
5 0.42
6 0.36
7 0.38
8 0.4
9 0.4
10 0.39
11 0.36
12 0.33
13 0.3
14 0.26
15 0.22
16 0.19
17 0.14
18 0.14
19 0.2
20 0.19
21 0.26
22 0.28
23 0.31
24 0.34
25 0.39
26 0.42
27 0.39
28 0.44
29 0.38
30 0.36
31 0.33
32 0.29
33 0.24
34 0.17
35 0.15
36 0.1
37 0.07
38 0.07
39 0.08
40 0.08
41 0.11
42 0.13
43 0.14
44 0.14
45 0.15
46 0.2
47 0.2
48 0.21
49 0.19
50 0.19
51 0.22
52 0.27
53 0.27
54 0.22
55 0.21
56 0.24
57 0.22
58 0.21
59 0.16
60 0.13
61 0.12
62 0.11
63 0.12
64 0.11
65 0.11
66 0.12
67 0.12
68 0.13
69 0.13
70 0.2
71 0.22
72 0.27
73 0.31
74 0.33
75 0.35
76 0.32
77 0.32
78 0.31
79 0.28
80 0.23
81 0.2
82 0.19
83 0.17
84 0.18
85 0.21
86 0.15
87 0.15
88 0.16
89 0.17
90 0.16
91 0.15
92 0.16
93 0.14
94 0.18
95 0.18
96 0.15
97 0.13
98 0.13
99 0.15
100 0.12
101 0.15
102 0.16
103 0.25
104 0.32
105 0.37
106 0.4
107 0.4
108 0.42
109 0.41
110 0.45
111 0.45
112 0.44
113 0.44
114 0.41
115 0.39
116 0.39
117 0.35
118 0.26
119 0.17
120 0.12
121 0.07
122 0.06
123 0.06
124 0.04
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.07
138 0.11
139 0.12
140 0.13
141 0.14
142 0.15
143 0.15
144 0.2
145 0.21
146 0.23
147 0.22
148 0.22
149 0.27
150 0.28
151 0.28
152 0.28
153 0.33
154 0.34
155 0.39
156 0.41
157 0.41
158 0.41
159 0.42
160 0.38
161 0.32
162 0.25
163 0.21
164 0.16
165 0.14
166 0.14
167 0.11
168 0.12
169 0.13
170 0.13
171 0.13
172 0.13
173 0.15
174 0.18
175 0.22
176 0.24
177 0.22
178 0.21
179 0.21
180 0.23
181 0.21
182 0.18
183 0.14
184 0.13
185 0.13
186 0.13
187 0.14
188 0.12
189 0.12
190 0.11
191 0.15
192 0.16
193 0.2
194 0.23
195 0.24
196 0.25
197 0.3
198 0.37
199 0.41
200 0.46
201 0.52
202 0.54
203 0.59
204 0.6
205 0.56
206 0.5
207 0.51
208 0.51
209 0.52
210 0.57
211 0.59
212 0.66
213 0.73
214 0.82
215 0.84
216 0.85
217 0.85
218 0.87
219 0.87
220 0.88
221 0.85
222 0.79
223 0.71
224 0.62
225 0.53
226 0.43
227 0.33
228 0.27
229 0.3
230 0.32
231 0.38
232 0.44
233 0.5
234 0.58
235 0.62
236 0.68
237 0.66
238 0.63
239 0.6
240 0.59
241 0.55
242 0.47
243 0.43
244 0.35
245 0.28
246 0.24
247 0.18
248 0.12
249 0.09
250 0.11
251 0.12
252 0.12
253 0.16
254 0.17
255 0.19
256 0.2
257 0.24
258 0.22
259 0.26
260 0.29
261 0.34
262 0.36
263 0.36