Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RGM6

Protein Details
Accession F4RGM6    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
19-41LADSNKPRTRKGKKNKNLTTVLEHydrophilic
NLS Segment(s)
PositionSequence
24-33KPRTRKGKKN
Subcellular Location(s) nucl 19, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
KEGG mlr:MELLADRAFT_104961  -  
Amino Acid Sequences MSTPNLPENLPPRANTPALADSNKPRTRKGKKNKNLTTVLEGEGEGSDSKEGEENGNTDHLNVNSTGGTRDNDHGREDNNEGNQSNETRDSIGEEDRAGRIGNITGIGPDVENMAEPVQIEHGHAKWLYNIKEALDRDMM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.32
3 0.32
4 0.3
5 0.32
6 0.33
7 0.33
8 0.35
9 0.44
10 0.49
11 0.46
12 0.47
13 0.53
14 0.61
15 0.69
16 0.73
17 0.74
18 0.77
19 0.87
20 0.89
21 0.87
22 0.83
23 0.76
24 0.7
25 0.61
26 0.53
27 0.42
28 0.33
29 0.25
30 0.18
31 0.15
32 0.1
33 0.08
34 0.06
35 0.05
36 0.06
37 0.07
38 0.07
39 0.07
40 0.08
41 0.08
42 0.09
43 0.11
44 0.1
45 0.1
46 0.11
47 0.1
48 0.1
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.09
57 0.11
58 0.13
59 0.14
60 0.16
61 0.16
62 0.16
63 0.18
64 0.19
65 0.19
66 0.18
67 0.19
68 0.17
69 0.17
70 0.18
71 0.16
72 0.15
73 0.13
74 0.12
75 0.11
76 0.11
77 0.12
78 0.12
79 0.13
80 0.12
81 0.11
82 0.12
83 0.12
84 0.12
85 0.1
86 0.08
87 0.08
88 0.08
89 0.08
90 0.07
91 0.07
92 0.06
93 0.07
94 0.07
95 0.06
96 0.06
97 0.06
98 0.05
99 0.05
100 0.06
101 0.06
102 0.06
103 0.07
104 0.07
105 0.09
106 0.09
107 0.11
108 0.13
109 0.13
110 0.17
111 0.17
112 0.17
113 0.21
114 0.28
115 0.28
116 0.29
117 0.3
118 0.28
119 0.35
120 0.36